spacer

EBI Dbfetch

ID   JX282183; SV 1; linear; genomic DNA; STD; HUM; 1482 BP.
XX
AC   JX282183;
XX
DT   24-SEP-2012 (Rel. 114, Created)
DT   30-JUN-2013 (Rel. 117, Last updated, Version 2)
XX
DE   Homo sapiens isolate M0346 MICB antigen gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1482
RX   DOI; 10.1007/s00251-013-0699-4.
RX   PUBMED; 23549730.
RA   Ying Y., He Y., Tao S., Han Z., Wang W., Chen N., He J., Zhang W., He J.,
RA   Zhu F., Lv H.;
RT   "Distribution of MICB diversity in the Zhejiang Han population: PCR
RT   sequence-based typing for exons 2-6 and identification of five novel MICB
RT   alleles";
RL   Immunogenetics 65(7):485-492(2013).
XX
RN   [2]
RP   1-1482
RA   Zhu F.M., Ying Y.L., He Y.M.;
RT   ;
RL   Submitted (07-JUL-2012) to the INSDC.
RL   HLA Laboratory, Transfusion Institute, Blood Center of Zhejiang Province,
RL   Wulin Road 345, Hangzhou, Zhejiang 310006, China
XX
DR   MD5; 591618311ef1c48dc5db6f9c636c2ac5.
DR   IMGT/HLA; MICB*027; HLA08422.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1482
FT                   /organism="Homo sapiens"
FT                   /isolate="M0346"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..255,356..643,744..1022,1123..1254,1355..>1482)
FT                   /product="MICB antigen"
FT   CDS             join(<1..255,356..643,744..1022,1123..1254,1355..1482)
FT                   /codon_start=3
FT                   /product="MICB antigen"
FT                   /note="activating NKG2D receptor"
FT                   /db_xref="GOA:J9V8A4"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:J9V8A4"
FT                   /protein_id="AFR77730.1"
FT                   /translation="PHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQ
FT                   GQWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTR
FT                   GSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADC
FT                   LQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSRNHGTHPVPSGKALVLQS
FT                   QRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQ
FT                   LGFQPLMSATGSTGSTEGA"
FT   gap             256..355
FT                   /estimated_length=unknown
FT   gap             644..743
FT                   /estimated_length=unknown
FT   variation       992
FT                   /replace="g"
FT   gap             1023..1122
FT                   /estimated_length=unknown
FT   gap             1255..1354
FT                   /estimated_length=unknown
XX
SQ   Sequence 1482 BP; 270 A; 290 C; 305 G; 217 T; 400 other;
     agccccacag tcttcgttac aacctcatgg tgctgtccca ggatggatct gtgcagtcag        60
     ggtttctcgc tgagggacat ctggatggtc agcccttcct gcgctatgac aggcagaaac       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggagctaag acctgggaca       180
     cagagaccga ggacttgaca gagaatgggc aagacctcag gaggaccctg actcatatca       240
     aggaccagaa aggagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngcttg       360
     cattccctcc aggagattag ggtctgtgag atccatgaag acagcagcac caggggctcc       420
     cggcatttct actacgatgg ggagctcttc ctctcccaaa acctggagac tcaagaatcg       480
     acagtgcccc agtcctccag agctcagacc ttggctatga acgtcacaaa tttctggaag       540
     gaagatgcca tgaagaccaa gacacactat cgcgctatgc aggcagactg cctgcagaaa       600
     ctacagcgat atctgaaatc cggggtggcc atcaggagaa cagnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnntgccccc catggtgaat gtcacctgca gcgaggtctc       780
     agagggcaac atcaccgtga catgcagggc ttccagcttc tatccccgga atatcacact       840
     gacctggcgt caggatgggg tatctttgag ccacaacacc cagcagtggg gggatgtcct       900
     gcctgatggg aatggaacct accagacctg ggtggccacc aggattcgcc aaggagagga       960
     gcagaggttc acctgctaca tggaacacag caggaatcac ggcactcacc ctgtgccctc      1020
     tgnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggaaggcg ctggtgcttc      1140
     agagtcaacg gacagacttt ccatatgttt ctgctgctat gccatgtttt gttattatta      1200
     ttattctctg tgtcccttgt tgcaagaaga aaacatcagc ggcagagggt ccagnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnagcttg tgagcctgca ggtcctggat      1380
     caacacccag ttgggacagg agaccacagg gatgcagcac agctgggatt tcagcctctg      1440
     atgtcagcta ctgggtccac tggttccact gagggcgcct ag                         1482
//


spacer
spacer