spacer

EBI Dbfetch

ID   JX196202; SV 1; linear; genomic DNA; STD; HUM; 3154 BP.
XX
AC   JX196202;
XX
DT   03-JUL-2012 (Rel. 113, Created)
DT   03-JUL-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B-B*44:02:01new allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3154
RA   Sayer D.C., Alizadeh M., Hogan H.M., Senitzer D., Gendzekhadze K.,
RA   Humphreys I.;
RT   "New HLA class I alleles containing non-coding haplotype-specific SNPs";
RL   Unpublished.
XX
RN   [2]
RP   1-3154
RA   Sayer D.C., Alizadeh M., Hogan H.M., Senitzer D., Gendzekhadze K.,
RA   Humphreys I.;
RT   ;
RL   Submitted (19-JUN-2012) to the INSDC.
RL   Conexio Genomics, 8/31 Pakenham St, Fremantle, WA 6160, Australia
XX
DR   Ensembl-Gn; ENSG00000228964; homo_sapiens.
DR   Ensembl-Tr; ENST00000421349; homo_sapiens.
DR   IMGT/HLA; B*44:02:01:03; HLA08401.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3154
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <114..>2789
FT                   /gene="HLA-B"
FT                   /allele="B*44:02:01new"
FT   mRNA            join(<114..186,316..585,829..1104,1680..1955,2049..2165,
FT                   2607..2639,2746..>2789)
FT                   /gene="HLA-B"
FT                   /allele="B*44:02:01new"
FT                   /product="MHC class I antigen"
FT   CDS             join(114..186,316..585,829..1104,1680..1955,2049..2165,
FT                   2607..2639,2746..2789)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="B*44:02:01new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D5H3J5"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D5H3J5"
FT                   /protein_id="AFM91112.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   VTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   variation       1592
FT                   /gene="HLA-B"
FT                   /replace="t"
FT                   /note="intronic SNP; haplotype-specific"
XX
SQ   Sequence 3154 BP; 588 A; 910 C; 1003 G; 653 T; 0 other;
     ttcccactcc cattgggtgt cgggtgtcta gagaagccaa tcagtgtcgc cggggtccca        60
     gttctaaagt ccccacgcac ccacccggac tcagaatctc ctcagacgcc gagatgcggg       120
     tcacggcgcc ccgaaccctc ctcctgctgc tctggggggc agtggccctg accgagacct       180
     gggccggtga gtgcggggtc gggagggaaa tggcctctgt ggggaggaga gaggggaccg       240
     caggcggggg cgcaggaccc ggggagccgc gccgggagga gggtcgggcg ggtctcagcc       300
     cctcctcgcc cccaggctcc cactccatga ggtatttcta caccgccatg tcccggcccg       360
     gccgcgggga gccccgcttc atcaccgtgg gctacgtgga cgacacgctg ttcgtgaggt       420
     tcgacagcga cgccacgagt ccgaggaagg agccgcgggc gccatggata gagcaggagg       480
     ggccggagta ttgggaccgg gagacacaga tctccaagac caacacacag acttaccgag       540
     agaacctgcg caccgcgctc cgctactaca accagagcga ggccggtgag tgaccccggc       600
     ccggggcgca ggtcacgact ccccatcccc cacgtacggc ccgggtcgcc ccgagtctcc       660
     gggtccgaga tccgcccccg aggccgcggg acccgcccag accctcgacc ggcgagagcc       720
     ccaggcgcgt ttacccggtt tcattttcag ttgaggccaa aatccccgcg ggttggtcgg       780
     ggcggggcgg ggctcggggg acggggctga ccgcggggcc ggggccaggg tctcacatca       840
     tccagaggat gtacggctgc gacgtggggc cggacgggcg cctcctccgc gggtatgacc       900
     aggacgccta cgacggcaag gattacatcg ccctgaacga ggacctgagc tcctggaccg       960
     cggcggacac cgcggctcag atcacccagc gcaagtggga ggcggcccgt gtggcggagc      1020
     aggacagagc ctacctggag ggcctgtgcg tggagtcgct ccgcagatac ctggagaacg      1080
     ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc ccatctccta      1140
     taggtcgccg gggatggcct cccacgagaa gaggaggaaa atgggatcag cgctagaatg      1200
     tcgccctccc ttgaatggag aatggcatga gttttcctga gtttcctctg agggccccct      1260
     cttctctcta ggacaattaa gggatgacgt ctctgaggaa atggagggga agacagtccc      1320
     tagaatactg atcaggggtc ccctttgacc cctgcagcag ccttgggaac cgtgactttt      1380
     cctctcaggc cttgttctct gcctcacact cagtgtgttt ggggctctga ttccagcact      1440
     tctgagtcac tttacctcca ctcagatcag gagcagaagt ccctgttccc cgctcagaga      1500
     ctcgaacttt ccaatgaata ggagattatc ccaggtgcct gcgtccaggc tggtgtctgg      1560
     gttctgtgcc ccttccccac cccaggtgtc ccgtccattc tcaggctggt cacatgggtg      1620
     gtcctagggt gtcccatgag agatgcaaag cgcctgaatt ttctgactct tcccatcaga      1680
     ccccccaaag acacatgtga cccaccaccc catctctgac catgaggtca ccctgaggtg      1740
     ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg atggcgagga      1800
     ccaaactcag gacaccgagc ttgtggagac cagaccagca ggagatagaa ccttccagaa      1860
     gtgggcagct gtggtggtgc cttctggaga agagcagaga tacacatgcc atgtacagca      1920
     tgaggggctg ccgaagcccc tcaccctgag atggggtaag gagggggatg aggggtcata      1980
     tctcttctca gggaaagcag gagcccttca gcagggtcag ggcccctcat cttcccttcc      2040
     tttcccagag ccgtcttccc agtccaccgt ccccatcgtg ggcattgttg ctggcctggc      2100
     tgtcctagca gttgtggtca tcggagctgt ggtcgctgct gtgatgtgta ggaggaagag      2160
     ctcaggtagg gaaggggtga ggggtggggt ctgggttttc ttgtcccact gggggtttca      2220
     agccccaggt agaagtgttc cctgcctcat tactgggaag cagcatccac acaggggcta      2280
     acgcagcctg ggaccctgtg tgccagcact tactcttttg tgcagcacat gtgacaatga      2340
     aggacggatg tatcaccttg gtggttgtgg tgttggggtc ctgattccag cattcatgag      2400
     tcaggggaag gtccctgcta aggacagacc ttaggagggc agttggtcca ggacccacac      2460
     ttgctttcct cgtgtttcct gatcctgcct tgggtctgta gtcatacttc tggaaattcc      2520
     ttttgggtcc aagacgagga ggttcctcta agatctcatg gccctgcttc ctcccagtcc      2580
     cctcacaggg cattttcttc ccacaggtgg aaaaggaggg agctactctc aggctgcgtg      2640
     taagtgatgg gggcgggagt gtggaggagc tcacccaccc cataattcct cctgtcccac      2700
     gtctcctgcg ggctctgacc aggtcctgtt tttgttctac tccaggcagc gacagtgccc      2760
     agggctctga tgtgtctctc acagcttgaa aaggtgagat tcttggggtc tagagtgggt      2820
     ggggtggcag gtctgggggt gggtggggca gtggggaaag gcctgggtaa tggagattct      2880
     ttgattggga tgtttcgcgt gtgtggtggg ctgtttagag tgtcatcact taccatgact      2940
     aaccagaatt tgttcatgac tgttgttttc tgtagcctga gacagctgtc ttgtgaggga      3000
     ctgagatgca ggatttcttc acgcctcccc tttgtgactt caagagcctc tggcatctct      3060
     ttctgcaaag gcacctgaat gtgtctgcgt ccctgttagc ataatgtgag gaggtggaga      3120
     gacagcccac ccccgtgtcc accgtgaccc ctgt                                  3154
//


spacer
spacer