Dbfetch

ID   JX139752; SV 1; linear; genomic DNA; STD; HUM; 1640 BP.
XX
AC   JX139752;
XX
DT   26-AUG-2012 (Rel. 113, Created)
DT   12-DEC-2012 (Rel. 115, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*18:79 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1640
RA   Endres R.O., Hoffman A.D., Palmer P., Scott I., Souza S.;
RT   "Characterization of the novel HLA-B*18:79 allele";
RL   Tissue Antigens 81:54-55(2012).
XX
RN   [2]
RP   1-1640
RA   Hoffman A.D., Scott I., Palmer P., Souza S., Endres R.O.;
RT   ;
RL   Submitted (06-JUN-2012) to the INSDC.
RL   HLA Laboratory, Blood Systems Laboratories, 2424 W. Erie Dr., Tempe, AZ
RL   85282, USA
XX
DR   MD5; 020a23b637f37551d6e7202b5b416d77.
DR   IMGT/HLA; B*18:79; HLA08392.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1640
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="USA"
FT                   /collection_date="03-May-2012"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1640
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18:79"
FT   mRNA            join(<1..270,517..792,1365..>1640)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18:79"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..792,1365..>1640)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18:79"
FT                   /product="MHC class I antigen"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:J7HI06"
FT                   /protein_id="AFP99303.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRHLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   gap             271..516
FT                   /estimated_length=246
FT   gap             793..1364
FT                   /estimated_length=572
XX
SQ   Sequence 1640 BP; 179 A; 261 C; 270 G; 112 T; 818 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacggca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccgt ggatagagca agaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagaac ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc tcacaccctc cagaggatgt       540
     acggctgcga cgtggggccg gacgggcgcc tcctccgcgg gcatgaccag tccgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgagctc ctggaccgcg gcggacaccg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag ctgagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagacacct ggagaacggg aaggagacgc       780
     tgcagcgcgc ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnaccccc caaagacaca      1380
     tgtgacccac caccccatct ctgaccatga ggccaccctg aggtgctggg ccctgggctt      1440
     ctaccctgcg gagatcacac tgacctggca gcgggatggc gaggaccaaa ctcaggacac      1500
     cgagcttgtg gagaccagac cagcaggaga tagaaccttc cagaagtggg cagctgtggt      1560
     ggtgccttct ggagaagagc agagatacac atgccatgta cagcatgagg ggctgccgaa      1620
     gcccctcacc ctgagatggg                                                  1640
//