spacer

EBI Dbfetch

ID   JX122439; SV 1; linear; genomic DNA; STD; HUM; 1646 BP.
XX
AC   JX122439;
XX
DT   20-AUG-2012 (Rel. 113, Created)
DT   20-AUG-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-G) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1646
RX   DOI; 10.1111/j.1399-0039.2012.01957.x.
RX   PUBMED; 22924559.
RA   Roger J., Faucher M.-C., Roger M.;
RT   "Identification of a new HLA-G allele, HLA-G*01:18, in a Canadian Caucasian
RT   individual";
RL   Tissue Antigens 80(5):472-473(2012).
XX
RN   [2]
RP   1-1646
RA   Roger J., Faucher M.-C., Roger M.;
RT   ;
RL   Submitted (31-MAY-2012) to the INSDC.
RL   Microbiology, Hopital Notre-Dame du CHUM, 1540 Sherbrooke Street East,
RL   Montreal, QC H2L 4M1, Canada
XX
DR   MD5; 598f9c75141948e62788e5a18029d42a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1646
FT                   /gene="HLA-G"
FT   mRNA            join(<1..270,497..772,1371..>1646)
FT                   /gene="HLA-G"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,497..772,1371..>1646)
FT                   /codon_start=3
FT                   /gene="HLA-G"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:J7H084"
FT                   /db_xref="IMGT/HLA:G*01:18"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:J7H084"
FT                   /protein_id="AFP89334.1"
FT                   /translation="SHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRME
FT                   PRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGS
FT                   DGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTC
FT                   VEWLHRYLENGKEMLQRADPAKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGED
FT                   QTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRW"
XX
SQ   Sequence 1646 BP; 326 A; 500 C; 524 G; 296 T; 0 other;
     gctcccactc catgaggtat ttcagcgccg ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc catgggctac gtggacgaca cgcagttcgt gcggttcgac agcgactcgg       120
     cgtgtccgag gatggagccg cgggcgccgt gggtggagca ggaggggcca gagtattggg       180
     aagaggagac acggaacacc aaggcccacg cacagactga cagaatgaac ctgcagaccc       240
     tgcgcggcta ctacaaccag agcgaggcca gtgagtaacc ccggcccagg gcgcagatca       300
     cgacccccca cctccatgcc ccacggacgc cccgggtact cccgagtctc cgggtctggg       360
     atccaccccg aggccgcggg acccgcccag accctctacc tgggagaacc ccaggcgcct       420
     ttaccaaaat ccctgcgggt gggtccgggc gagggcgagg ctcggtgggc ggggctgacc       480
     gaaggggtgg ggccaggttc tcataccctc cagtggatga ttggctgcga cctggggtcc       540
     gacggacgcc tcctccgcgg gtatgaacag tatgcctacg atggcaagga ttacctcgcc       600
     ctgaacgagg acctgcgctc ctggaccgca gcggacactg cggctcagat ctccaagcgc       660
     aagtgtgagg cggccaatgt ggctgaacaa aggagagcct acctggaggg cacgtgcgtg       720
     gagtggctcc acagatacct ggagaacggg aaggagatgc tgcagcgcgc gggtaccagg       780
     ggcagtgggg cgcctccctg atctcctgta gacctcccag cctggcctag cacaaggaga       840
     ggaggaaaat gggaccaaca ccagaatatc gccctccctc tggtcctgag ggagagaatc       900
     ctcctgggtt tccagatcct gtaccagaga gtgattctga gggcccgtcc tgctctctgg       960
     gacaattaag ggatgaagtc tctgagggag tggaggggaa gacaatccct ggaggactga      1020
     tcaggggttc cctttgaccc cacagcagcc ttggcaccag gacttttccc ctcaggcctt      1080
     gttctctgcc tcacactcaa tgtgtgtggg agtctgactc cagctcctct gagtcccttg      1140
     gcctccactc aggtcagaac cagaggtccc tgctcccccg ctcagagact agaactttcc      1200
     aaggaatagg agattatccc aggtgcccgt gtccaggctg gtgtctgggt tctgtgctcc      1260
     cttccccacc ccaggtatct ggttcattct taggatggtc acatccaggt gctgctggag      1320
     tgtcccatga gagatgcaaa gtgcttgagt tttctgactc ttcctttcag accccgccaa      1380
     gacacacgtg acccaccacc ctgtctttga ctatgaggcc accctgaggt gctgggccct      1440
     gggcttctac cctgcggaga tcatactgac ctggcagcgg gatggggagg accagaccca      1500
     ggacgtggag ctcgtggaga ccaggcctgc aggggatgga accttccaga agtgggcagc      1560
     tgtggtggtg ccttctggag aggagcagag atacacgtgc catgtgcagc atgaggggct      1620
     gccggagccc ctcatgctga gatgga                                           1646
//


spacer
spacer