spacer

EBI Dbfetch

ID   JX119189; SV 1; linear; genomic DNA; STD; HUM; 852 BP.
XX
AC   JX119189;
XX
DT   19-AUG-2012 (Rel. 113, Created)
DT   27-JUN-2013 (Rel. 117, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-852
RX   DOI; 10.1111/tan.12110.
RX   PUBMED; 23574607.
RA   Chen P.L., Lai S.K., Yang W.S., Chang T.C., Chu C.C.;
RT   "Identification of a novel HLA-B allele, B*07:162, in a Taiwanese
RT   individual";
RL   Tissue Antigens 82(1):60-62(2013).
XX
RN   [2]
RP   1-852
RA   Chu C.-C., Chang T.-C.;
RT   ;
RL   Submitted (30-MAY-2012) to the INSDC.
RL   Department of Medical Research, Mackay Memorial Hospital, Taiwan
XX
DR   MD5; 624a5356444da1bad658985731faca8e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..852
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>852
FT                   /gene="HLA-B"
FT   mRNA            join(<31..300,546..>821)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(<31..300,546..>821)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:J7H547"
FT                   /db_xref="IMGT/HLA:B*07:162"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:J7H547"
FT                   /protein_id="AFP87507.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
XX
SQ   Sequence 852 BP; 149 A; 287 C; 304 G; 112 T; 0 other;
     gggcgggtct cagcccctcc tcacccccag gctcccactc catgaggtat ttctacacct        60
     ccgtgtcccg gcccggccgc ggggagcccc gcttcatctc agtgggctac gtggacgaca       120
     cccagttcgt gaggttcgac agcgacgccg cgagtccgag agaggagccg cgggcgccgt       180
     ggatagagca ggaggggccg gagtattggg accggaacac acagatctac aaggcccagg       240
     cacagactga ccgagagagc ctgcggaacc tgcgcggcta ctacaaccag agcgaggccg       300
     gtgagtgacc ccggcccggg gcgcaggtca cgactcccca tcccccacgt acggcccggg       360
     tcgccccgag tctccgggtc cgagatccgc ctccctgagg ccgcgggacc cgcccagacc       420
     ctcgaccggc gagagcccca ggcgcgttta cccggtttca ttttcagttg aggccaaaat       480
     ccccgcgggt tggtcggggc ggggcggggc tcgggggacg gggctgaccg cggggccggg       540
     gccagggtct cacatcatcc agaggatgta tggctgcgac ctggggcccg acgggcgcct       600
     cctccgcggg catgaccagt ccgcctacga cggcaaggat tacatcgccc tgaacgagga       660
     cctgcgctcc tggaccgccg cggacacggc ggctcagatc acccagcgca agtgggaggc       720
     ggcccgtgag gcggagcagc ggagagccta cctggagggc gagtgcgtgg agtggctccg       780
     cagatacctg gagaacggga aggacaagct ggagcgcgct ggtaccaggg gcagtgggga       840
     gccttcccca tc                                                           852
//


spacer
spacer