spacer

EBI Dbfetch

ID   JX088038; SV 1; linear; genomic DNA; STD; HUM; 1021 BP.
XX
AC   JX088038;
XX
DT   10-JAN-2013 (Rel. 115, Created)
DT   10-JAN-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens clone F01854 truncated MHC class I antigen (HLA-B) gene,
DE   HLA-B*40V allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1021
RA   Du K., Yang J., Liu Y., Zheng J., Xie J., Sun Y.;
RT   ;
RL   Submitted (11-MAY-2012) to the INSDC.
RL   Blood Typing Lab, Shanghai Blood Center, 1191 Hongqiao Road, Shanghai
RL   200051, China
XX
DR   MD5; bbee60261f954c2f3cc6dfe7870667e3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1021
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="F01854"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1021
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40V"
FT   mRNA            join(<1..270,371..>477)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40V"
FT                   /product="truncated MHC class I antigen"
FT   CDS             join(<1..270,371..477)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40V"
FT                   /product="truncated MHC class I antigen"
FT                   /db_xref="GOA:L7QJ94"
FT                   /db_xref="IMGT/HLA:B*40:216N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:L7QJ94"
FT                   /protein_id="AGB75977.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGR
FT                   TGASSAGITSTPTTARITSP"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   gap             646..745
FT                   /estimated_length=unknown
XX
SQ   Sequence 1021 BP; 181 A; 254 C; 271 G; 115 T; 200 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacgtggg gcggacgggc       420
     gcctcctccg cgggcataac cagtacgcct acgacggcaa ggattacatc gccctgaacg       480
     aggacctgcg ctcctggacc gccgcggaca cggcggctca gatctcccag cgcaagttgg       540
     aggcggcccg tgtggcggag cagctgagag cctacctgga gggcgagtgc gtggagtggc       600
     tccgcagata cctggagaac gggaaggaca agctggagcg cgctgnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnacccc ccaaagacac acgtgaccca ccaccccatc       780
     tctgaccatg aggccaccct gaggtgctgg gccctgggtt tctaccctgc ggagatcaca       840
     ctgacctggc agcgggatgg cgaggaccaa actcaggaca ctgagcttgt ggagaccaga       900
     ccagcaggag atagaacctt ccagaagtgg gcagctgtgg tggtgccttc tggagaagag       960
     cagagataca catgccatgt acagcatgag gggctgccga agcccctcac cctgagatgg      1020
     g                                                                      1021
//


spacer
spacer