spacer

EBI Dbfetch

ID   JX088035; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JX088035;
XX
DT   10-JAN-2013 (Rel. 115, Created)
DT   10-JAN-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens clone E09023 MHC class I antigen (HLA-DRB1) gene, HLA-DRB1*04V
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Xie J., Yang J., Zheng J., Sun Y., Liu Y., Ji J., Du K.;
RT   ;
RL   Submitted (10-MAY-2012) to the INSDC.
RL   Blood Typing Lab, Shanghai Blood Center, 1191 Hongqiao Road, Shanghai
RL   200051, China
XX
DR   MD5; 8246c3459f276949885e29a1e21610cf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="E09023"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04V"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04V"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04V"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:L7QJG9"
FT                   /db_xref="IMGT/HLA:DRB1*04:125"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:L7QJG9"
FT                   /protein_id="AGB75974.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDILEQKRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 61 A; 65 C; 97 G; 47 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacatcct ggagcagaag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer