Dbfetch

ID   JX069944; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JX069944;
XX
DT   01-AUG-2012 (Rel. 113, Created)
DT   27-JUN-2013 (Rel. 117, Last updated, Version 2)
XX
DE   Homo sapiens isolate LIGH101292 MHC class II antigen (HLA-DRB1) gene,
DE   HLA-DRB1*var allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/tan.12089.
RX   PUBMED; 23489469.
RA   Wowk P.F., Mattar S.B., Bicalho M.G.;
RT   "Identification of a new HLA-DRB1*11 variant, HLA-DRB1*11:130, by
RT   sequence-based typing in a Brazilian individual";
RL   Tissue Antigens 81(6):469-470(2013).
XX
RN   [2]
RP   1-270
RA   Bicalho Md.G., Mattar S.B., Wowk P.F.;
RT   ;
RL   Submitted (16-MAY-2012) to the INSDC.
RL   Departamento de Genetica, Universidade Federal do Parana, Rua Francisco H
RL   dos Santos, s/n, Curitiba, Parana 81530-980, Brasil
XX
DR   MD5; 9ab9238711ff887c56ad24bf4bd0f76f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /isolate="LIGH101292"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="bone marrow donor"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*var"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*var"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*var"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:I7D962"
FT                   /db_xref="IMGT/HLA:DRB1*11:130"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I7D962"
FT                   /protein_id="AFO70160.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEDYWNSQKDLLEDRRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*var"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 64 C; 96 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggactactgg aacagccaga       180
     aggacctcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//