spacer

EBI Dbfetch

ID   JX067628; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JX067628;
XX
DT   30-MAY-2012 (Rel. 112, Created)
DT   30-MAY-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Homo sapiens isolate 56748 MHC class I antigen (HLA) gene, HLA-DRB1*12new
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Liu S.;
RT   "A novel HLA-DRB1*12 allele tested by PCR-SBT";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Liu S.;
RT   ;
RL   Submitted (14-MAY-2012) to the INSDC.
RL   HLAlab, Shannxi Blood Center, 407# Zhuque Street, Xi`an, Shannxi 710061,
RL   China
XX
DR   MD5; 3fb4a0520c53b6aa4cf5f629ec39451c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /isolate="56748"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA"
FT                   /allele="HLA-DRB1*12new"
FT   mRNA            <1..>270
FT                   /gene="HLA"
FT                   /allele="HLA-DRB1*12new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA"
FT                   /allele="HLA-DRB1*12new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:I3TBB7"
FT                   /db_xref="IMGT/HLA:DRB1*12:36"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I3TBB7"
FT                   /protein_id="AFK49809.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRLLERHFHNQEELLRLDSDVGEFRAV
FT                   TELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA"
FT                   /allele="HLA-DRB1*12new"
FT                   /number=2
FT   variation       107
FT                   /gene="HLA"
FT                   /replace="c"
XX
SQ   Sequence 270 BP; 55 A; 66 C; 99 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttactgga gagacacttc cataaccagg aggagctcct gcgcttggac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaagacagg cgcgccgcgg tggacaccta ttgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer