spacer

EBI Dbfetch

ID   JX050174; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JX050174;
XX
DT   05-AUG-2012 (Rel. 113, Created)
DT   05-AUG-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*02:01:var
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Zollikofer C., Fuerst D., Mytilineos J.;
RT   ;
RL   Submitted (14-MAY-2012) to the INSDC.
RL   IKT Ulm, Helmholtzstrasse 10, Ulm 89081, Germany
XX
DR   MD5; b79eb7a090da1eac0517715674e43c34.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*02:01:var"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*02:01:var"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*02:01:var"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:I7EL85"
FT                   /db_xref="IMGT/HLA:DQB1*02:01:05"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I7EL85"
FT                   /protein_id="AFP19430.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAV
FT                   TLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRR"
XX
SQ   Sequence 270 BP; 62 A; 67 C; 95 G; 46 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggaca gagcgcgtgc        60
     gtcttgtgag cagaagcatc tataaccgag aagagatcgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg ctgctggggc tgcctgccgc cgagtactgg aacagccaga       180
     aggacatcct ggagaggaaa cgggcagcgg tggacagggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//


spacer
spacer