Dbfetch

ID   JX045664; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JX045664;
XX
DT   30-MAY-2012 (Rel. 112, Created)
DT   30-MAY-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA) gene, HLA-DRB1*04 allele, exon 2 and
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Qi J.;
RT   "A novel HLA-DRB1*04 allele tested by SBT";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Qi J.;
RT   ;
RL   Submitted (10-MAY-2012) to the INSDC.
RL   HLAlab, Shannxi Blood Center, 407# Zhuque Street, Xi`an, Shannxi 710061,
RL   China
XX
DR   MD5; 0142a696244081578b3db603e8d4e9e5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA"
FT                   /allele="HLA-DRB1*04"
FT   mRNA            <1..>270
FT                   /gene="HLA"
FT                   /allele="HLA-DRB1*04"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA"
FT                   /allele="HLA-DRB1*04"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:I3TBB6"
FT                   /db_xref="IMGT/HLA:DRB1*04:114"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I3TBB6"
FT                   /protein_id="AFK49808.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQKRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA"
FT                   /allele="HLA-DRB1*04"
FT                   /number=2
FT   variation       199
FT                   /gene="HLA"
FT                   /replace="g"
XX
SQ   Sequence 270 BP; 60 A; 65 C; 97 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cgggccgagg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//