Dbfetch

ID   JX040451; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   JX040451;
XX
DT   31-JUL-2012 (Rel. 113, Created)
DT   31-JUL-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens isolate sample ID 7311122958 MHC class II antigen (HLA-DRB1)
DE   gene, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Liu F., Su Y.P., Dai M., Su X.H.;
RT   "A new HLA-DRB1 allele is found through SBT in Yueyang Population sample ID
RT   7311122958";
RL   Unpublished.
XX
RN   [2]
RP   1-652
RA   Liu F., Su Y.P., Dai M., Su X.H.;
RT   ;
RL   Submitted (10-MAY-2012) to the INSDC.
RL   Institute Of Transfusion Medicine Of Yueyang, The Central Blood Station Of
RL   Yueyang City, Baiyangpo Road 245, Yueyang, Hunan 414000, China
XX
DR   MD5; 982e257b0e551916a04c3a8390a0beb6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /isolate="sample ID 7311122958"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>652
FT                   /gene="HLA-DRB1"
FT   mRNA            join(<1..270,371..>652)
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:I7C0V1"
FT                   /db_xref="IMGT/HLA:DRB1*09:19"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I7C0V1"
FT                   /protein_id="AFO64625.1"
FT                   /translation="RFLKQDKFECHFFNGMERVRYLHRGIYNQEENVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDFLERRRAEVDTVCRHNYGVGESFTVQRRVHPEVTVYPAKTQPL
FT                   QHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSVMSPLTVEW"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..652
FT                   /gene="HLA-DRB1"
FT                   /number=3
XX
SQ   Sequence 652 BP; 124 A; 134 C; 186 G; 108 T; 100 other;
     cacgtttctt gaagcaggat aagtttgagt gtcatttctt caacgggatg gagcgggtgc        60
     ggtatctgca cagaggcatc tataaccaag aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacttcct ggagcggagg cgggccgagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagaggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tccatcctga ggtgactgtg tatcctgcca agactcagcc cctgcagcac       420
     cacaacctcc tggtctgctc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaacg gccaggaaga gaaggctggg gtggtgtcca caggcctgat ccagaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaagtttac       600
     acctgccaag tggagcaccc aagtgtgatg agccctctca cagtggaatg ga               652
//