spacer

EBI Dbfetch

ID   JX029973; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JX029973;
XX
DT   01-AUG-2012 (Rel. 113, Created)
DT   01-AUG-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*03 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Loacker K., Hoertnagl P., Muehlbacher A.;
RT   "A novel HLA-DQB1 allele detected by sequence-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Loacker K., Hoertnagl P., Muehlbacher A.;
RT   ;
RL   Submitted (09-MAY-2012) to the INSDC.
RL   Tissue Typing Laboratory & Molecular Blood Group Diagnostics, Central
RL   Institute for Blood Transfusion & Department of Immunlology, Anichstrasse
RL   35, Innsbruck, Tyrol 6020, Austria
XX
DR   MD5; 63d10319b4423419ad444bff97856f60.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03"
FT                   /product="MHC class II antigen"
FT                   /note="antigen presenting molecule"
FT                   /db_xref="GOA:I7CBQ5"
FT                   /db_xref="IMGT/HLA:DQB1*03:44"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I7CBQ5"
FT                   /protein_id="AFO70101.1"
FT                   /translation="DFVYQFKAMCYFTNGTERVRYVTRYICNREEYARFDSDVEVYRAV
FT                   TPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR"
XX
SQ   Sequence 270 BP; 61 A; 71 C; 93 G; 45 T; 0 other;
     aggatttcgt gtaccagttt aaggccatgt gctacttcac caacgggacg gagcgcgtgc        60
     gttatgtgac cagatacatc tgtaaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     aggtgtaccg ggcggtgacg ccgctggggc cgcctgacgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//


spacer
spacer