spacer

EBI Dbfetch

ID   JX028302; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JX028302;
XX
DT   30-JUL-2012 (Rel. 113, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1201variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   PUBMED; 23126463.
RA   Kim K.M., Sung H.Y., Kang M.S., Huh J.Y.;
RT   "Identification of two novel HLA alleles: HLA-DRB1*12:03:03 and
RT   HLA-DRB1*13:143";
RL   Tissue Antigens 81(1):58-59(2013).
XX
RN   [2]
RP   1-270
RA   Huh J.Y., Sung H.Y.;
RT   ;
RL   Submitted (08-MAY-2012) to the INSDC.
RL   Laboratory Medicine, CHA Bundang Medical Center, CHA University, 351
RL   Yatap-dong, Bundang-gu, Seongnam-si, Gyeonggi-do 463-712, South Korea
XX
DR   MD5; 8be1ef0bb9ef134268cff2f4fb9b5fac.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1201variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1201variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1201variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:I7CHF2"
FT                   /db_xref="IMGT/HLA:DRB1*12:03:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I7CHF2"
FT                   /protein_id="AFO53509.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAV
FT                   TELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 55 A; 66 C; 98 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttactgga gagacacttc cataaccagg aggagctcct gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaagacagg cgcgccgcgg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer