Dbfetch

ID   JQ979296; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JQ979296;
XX
DT   29-JUL-2012 (Rel. 113, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (DRB1) gene, DRB1*13:05:01 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/tan.12155.
RX   PUBMED; 23849077.
RA   Zheng J.W., Yang J.H., Xie J.H., Liu Y., Sun Y., Jiang Y.Q., Tang Q.J.,
RA   Du K.M.;
RT   "Characterization of the novel HLA-DRB1*13:26:02 allele";
RL   Tissue Antigens 82(2):152-153(2013).
XX
RN   [2]
RP   1-270
RA   Yang J.H., Du K.M., Zhang R.F., Zheng J.W., Liu Y., Sun Y., Xie J.H.;
RT   ;
RL   Submitted (24-APR-2012) to the INSDC.
RL   Blood Typing Lab, Shanghai Blood Center, 191 Hongqiao Road, Shanghai
RL   200051, China
XX
DR   MD5; 125d07efef7c906b32be29e118aa4b9c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="DRB1"
FT                   /allele="DRB1*13:05:01"
FT   mRNA            <1..>270
FT                   /gene="DRB1"
FT                   /allele="DRB1*13:05:01"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="DRB1"
FT                   /allele="DRB1*13:05:01"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:I7ARY2"
FT                   /db_xref="IMGT/HLA:DRB1*13:26:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I7ARY2"
FT                   /protein_id="AFN89842.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 58 A; 64 C; 98 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//