spacer

EBI Dbfetch

ID   JQ965806; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JQ965806;
XX
DT   23-JUL-2012 (Rel. 113, Created)
DT   23-JUL-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*15:01:01
DE   variant allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Moraes M.E., Torres M.A., Campiotto S.;
RT   ;
RL   Submitted (20-APR-2012) to the INSDC.
RL   Jrm-Investigacoes Imunologicas, Rua Sorocaba 464 - Sala 305, Rio de
RL   Janeiro, Rio de Janeiro 22271-110, Brazil
XX
DR   MD5; 5438898a23a6234265ca6f6f58fd9a10.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: assign SBT v. 3.5.1.42; HLA SBT uType v.
CC                            6.0
CC   Sequencing Technology :: sbt - protrans - abbott - invitrogen
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15:01:01 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15:01:01 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15:01:01 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:I6Z114"
FT                   /db_xref="IMGT/HLA:DRB1*15:76"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I6Z114"
FT                   /protein_id="AFN70959.1"
FT                   /translation="RFLWQPKRECHFFNGTEPVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15:01:01 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 67 C; 100 G; 48 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagccggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer