spacer

EBI Dbfetch

ID   JQ963274; SV 1; linear; genomic DNA; STD; HUM; 1798 BP.
XX
AC   JQ963274;
XX
DT   21-JUN-2012 (Rel. 113, Created)
DT   21-JUN-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens isolate CTM-9097572 MHC class I antigen (HLA-A) gene, HLA-A*29
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1798
RA   Balas A., Vicario J.L.;
RT   "Sequence of a novel A*29 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1798
RA   Balas A., Vicario J.L.;
RT   ;
RL   Submitted (30-MAR-2012) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre of Madrid, Avenida de la
RL   Democracia S/N, Madrid 28032, Spain
XX
DR   MD5; a6e676f7e0ec5246b57898a5361930e1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1798
FT                   /organism="Homo sapiens"
FT                   /isolate="CTM-9097572"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1798
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29"
FT   mRNA            join(<1..73,174..443,544..819,920..1195,1296..1412,
FT                   1513..1545,1646..1693,1794..>1798)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,544..819,920..1195,1296..1412,
FT                   1513..1545,1646..1693,1794..1798)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:I6R4N3"
FT                   /db_xref="IMGT/HLA:A*29:40"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:I6R4N3"
FT                   /protein_id="AFM43627.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAGQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   gap             74..173
FT                   /estimated_length=unknown
FT   gap             444..543
FT                   /estimated_length=unknown
FT   gap             820..919
FT                   /estimated_length=unknown
FT   gap             1196..1295
FT                   /estimated_length=unknown
FT   gap             1413..1512
FT                   /estimated_length=unknown
FT   gap             1546..1645
FT                   /estimated_length=unknown
FT   gap             1694..1793
FT                   /estimated_length=unknown
XX
SQ   Sequence 1798 BP; 213 A; 326 C; 372 G; 187 T; 700 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct tgggggccct ggccctgacc        60
     cagacctggg cggnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttcacca catccgtgtc ccggcccggc cgcggggagc cccgcttcat       240
     cgccgtgggc tacgtggacg acacgcagtt cgtgcggttt gacagcgacg ccgcgagcca       300
     gaggatggag ccgcgggcac cgtggataga gcaggagggg ccggagtatt gggacctgca       360
     gacacggaat gtgaaggccc agtcacagac tgaccgagcg aacctgggga ccctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnngttctca caccatccag atgatgtatg gctgcgacgt ggggtcggac gggcgcttcc       600
     tccgcgggta ccggcaggac gcctacgacg gcaaggatta catcgccttg aacgaggacc       660
     tgcgctcttg gaccgcggcg gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgtggc ggggcagttg agagcctacc tggagggcac gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcacggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna cgcccccaag acgcatatga ctcaccacgc tgtctctgac       960
     catgaggcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggggagga ccagacccag gacacggagc ttgtggagac caggcctgca      1080
     ggggatggaa ccttccagaa gtgggcgtct gtggtggtgc cttctggaca ggagcagaga      1140
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagccg tcttcccagc ccaccatccc      1320
     catcgtgggc atcattgctg gcctagttct ctttggagct gtgttcgctg gagctgtggt      1380
     cgctgctgtg aggtggagga ggaagagctc agnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnatagaaaa ggagggagct actctcaggc tgcaannnnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnngcagt gacagtgccc agggctctga tatgtctctc      1680
     acagcttgta aagnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnntgtga        1798
//


spacer
spacer