spacer

EBI Dbfetch

ID   JQ952567; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   JQ952567;
XX
DT   26-JUN-2012 (Rel. 113, Created)
DT   27-JUN-2013 (Rel. 117, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*50 variant allele,
DE   exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RX   DOI; 10.1111/tan.12084.
RX   PUBMED; 23646955.
RA   Azzarone R., Canossi A., Cervelli C., Scimitarra M., Papola F.;
RT   "Identification of the novel HLA-B*50:18 allele variant in an Italian
RT   unrelated bone marrow donor";
RL   Tissue Antigens 81(6):466-468(2013).
XX
RN   [2]
RP   1-1022
RA   Azzarone R., Canossi A., Cervelli C., Scimitarra M., Battistoni C.,
RA   Di Iulio B., Fracassi D., Scarnecchia M.A., Papola F.;
RT   "Identification of a novel HLA-B*50 allele variant in a DNA sample from an
RT   Italian unrelated bone marrow donor";
RL   Unpublished.
XX
RN   [3]
RP   1-1022
RA   Azzarone R., Canossi A., Cervelli C., Scimitarra M., Battistoni C.,
RA   Di Iulio B., Fracassi D., Scarnecchia M.A., Papola F.;
RT   ;
RL   Submitted (18-APR-2012) to the INSDC.
RL   San Salvatore Hospital, Regional Center of Immunohaematology and Tissue
RL   Typing ASL n.1, Institute C.N.R.-IFT, Via L. Natali, L'Aquila 67100, Italy
XX
DR   MD5; 2072f93407c779ae3f8254bb38845e69.
DR   IMGT/HLA; B*50:18; HLA08559.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="12000216"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /isolation_source="unrelated bone marrow transplantation"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*50 variant"
FT                   /note="similar to B*50:01:01"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*50 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*50 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:I6TKJ3"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:I6TKJ3"
FT                   /protein_id="AFM74034.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTWQRMYGCDLGP
FT                   DGRLLRGYNQLAYDGKDYIALNQDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*50 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*50 variant"
FT                   /number=3
FT   variation       481
FT                   /gene="HLA-B"
FT                   /replace="g"
FT                   /note="compared to HLA-B*50:01:01 allele"
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..1022
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*50 variant"
FT                   /number=4
XX
SQ   Sequence 1022 BP; 182 A; 254 C; 271 G; 115 T; 200 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac ttggcagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtataa ccagttagcc tacgacggca aggattacat cgccctgaac       480
     caggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaccc cccaaagaca catgtgaccc accaccccat       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gcgaggacca aactcaggac accgagcttg tggagaccag       900
     accagcagga gatagaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga       960
     gcagagatac acatgccatg tacagcatga ggggctgccg aagcccctca ccctgagatg      1020
     gg                                                                     1022
//


spacer
spacer