spacer

EBI Dbfetch

ID   JQ913142; SV 1; linear; genomic DNA; STD; HUM; 1641 BP.
XX
AC   JQ913142;
XX
DT   25-JUN-2012 (Rel. 113, Created)
DT   25-JUN-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40new allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1641
RA   Zhu C., Nie X., Zhang Y., Song Y., Zhuang Y., Liu Y., Qiao W.;
RT   "Identification of a novel HLA-B*40 allele by sequence-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-1641
RA   Zhu C., Nie X., Zhang Y., Song Y., Zhuang Y., Liu Y., Qiao W.;
RT   ;
RL   Submitted (06-APR-2012) to the INSDC.
RL   HLA Lab, The Blood Center of Shandong Province, 22 Shanshi East Road,
RL   Jinan, Shandong Province 250014, China
XX
DR   MD5; c98c9da8d842d2b8bc53632c234f5fb7.
DR   IMGT/HLA; B*40:230; HLA08931.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1641
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="China"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1641
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40new"
FT   mRNA            join(<1..270,516..791,1366..>1641)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..791,1366..>1641)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:I6RVJ2"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:I6RVJ2"
FT                   /protein_id="AFM56241.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYPESLRNLRGYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   gap             271..515
FT                   /estimated_length=245
FT   gap             792..1365
FT                   /estimated_length=574
XX
SQ   Sequence 1641 BP; 180 A; 255 C; 273 G; 114 T; 819 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta cccagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacacttggc agacgatgta       540
     tggctgcgac gtggggccgg acgggcgcct cctccgcggg cataaccagt acgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgcgctcc tggaccgccg cggacacggc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgtg gcggagcagc tgagagccta       720
     cctggagggc gagtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnacccc ccaaagacac      1380
     acgtgaccca ccaccccatc tctgaccatg aggccaccct gaggtgctgg gccctgggct      1440
     tctaccctgc ggagatcaca ctgacctggc agcgggatgg cgaggaccaa actcaggaca      1500
     ctgagcttgt ggagaccaga ccagcaggag atagaacctt ccagaagtgg gcagctgtgg      1560
     tggtgccttc tggagaagag cagagataca catgccatgt acagcatgag gggctgccga      1620
     agcccctcac cctgagatgg g                                                1641
//


spacer
spacer