spacer

EBI Dbfetch

ID   JQ899198; SV 1; linear; genomic DNA; STD; HUM; 1642 BP.
XX
AC   JQ899198;
XX
DT   25-JUN-2012 (Rel. 113, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*24new allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Publication Status: Available-Online prior to print
RP   1-1642
RX   DOI; 10.1111/tan.12335.
RX   PUBMED; 24646398.
RA   Zhu C., Zhang H.W., Zhang Y., Nie X.M.;
RT   "Three novel HLA-A*24 alleles identified in Chinese Han individuals";
RL   Tissue Antigens 0:0-0(2014).
XX
RN   [2]
RP   1-1642
RA   Zhu C., Song Y., Nie X., Zhang Y., Zhuang Y., Liu Y., Qiao W.;
RT   "Identification of a novel HLA-A*24 allele by sequence-based typing";
RL   Unpublished.
XX
RN   [3]
RP   1-1642
RA   Zhu C., Song Y., Nie X., Zhang Y., Zhuang Y., Liu Y., Qiao W.;
RT   ;
RL   Submitted (04-APR-2012) to the INSDC.
RL   HLA Lab, The Blood Center of Shandong Province, 22 Shanshi East Road,
RL   Jinan, Shandong Province 250014, China
XX
DR   MD5; 57cae1abd54dad2d67ac32b193829349.
DR   IMGT/HLA; A*24:224; HLA08923.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1642
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="China"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1642
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT   mRNA            join(<1..270,512..787,1367..>1642)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..787,1367..>1642)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:I6R2V6"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:I6R2V6"
FT                   /protein_id="AFM56239.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PQAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   gap             271..511
FT                   /estimated_length=241
FT   gap             788..1366
FT                   /estimated_length=579
XX
SQ   Sequence 1642 BP; 174 A; 250 C; 278 G; 120 T; 820 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg caggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccctccagat gatgtttggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cagatcacca agcgcaagtg ggaggcggcc catgtggcgg agcagcagag agcctacctg       720
     gagggcacgt gcgtggacgg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnaccc ccccaagaca      1380
     catatgaccc accaccccat ctctgaccat gaggccactc tgagatgctg ggccctgggc      1440
     ttctaccctg cggagatcac actgacctgg cagcgggatg gggaggacca gacccaggac      1500
     acggagcttg tggagaccag gcctgcaggg gatggaacct tccagaagtg ggcagctgtg      1560
     gtggtacctt ctggagagga gcagagatac acctgccatg tgcagcatga gggtctgccc      1620
     aagcccctca ccctgagatg gg                                               1642
//


spacer
spacer