spacer

EBI Dbfetch

ID   JQ898685; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JQ898685;
XX
DT   27-JUN-2012 (Rel. 113, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (DRB1*11) gene, DRB1*11 variant allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/tan.12196.
RX   PUBMED; 24033271.
RA   Jakubauskas A., Valatkaite B., Griskevicius L.;
RT   "Two novel HLA class II alleles, DRB1*11:131 and DQB1*05:01:05, identified
RT   by sequence-based typing";
RL   Tissue Antigens 82(4):299-300(2013).
XX
RN   [2]
RP   1-270
RA   Jakubauskas A.;
RT   ;
RL   Submitted (03-APR-2012) to the INSDC.
RL   Dept. of Molecular & Regenerative Medicine, Vilnius University Hospital
RL   Santariskiu Klinikos, Santariskiu 2, Vilnius 08661, Lithuania
XX
DR   MD5; cf29b4c43e6c3d1d5c1020eeedc7f65f.
DR   IMGT/HLA; DRB1*11:131; HLA08404.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="DRB1*11"
FT                   /allele="DRB1*11 variant"
FT   mRNA            <1..>270
FT                   /gene="DRB1*11"
FT                   /allele="DRB1*11 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="DRB1*11"
FT                   /allele="DRB1*11 variant"
FT                   /product="MHC class II antigen"
FT                   /note="exon 2"
FT                   /db_xref="GOA:I6TMU9"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I6TMU9"
FT                   /protein_id="AFM77728.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDLLEQKRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="DRB1*11"
FT                   /allele="DRB1*11 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 63 C; 97 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacctcct ggagcagaag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer