Dbfetch

ID   JQ896290; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   JQ896290;
XX
DT   25-JUN-2012 (Rel. 113, Created)
DT   25-JUN-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*07:01:01 variant
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Lazaro A.M., Nichol L., Hurley C.K.;
RT   "Novel HLA Class I Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-787
RA   Lazaro A.M., Nichol L., Hurley C.K.;
RT   ;
RL   Submitted (03-APR-2012) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; eae6e2b6c27a2c526efe06fafca4e4ce.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="BY00921"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>787
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07:01:01 variant"
FT   mRNA            join(<1..270,512..>787)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07:01:01 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07:01:01 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:C*07:141:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:I6R271"
FT                   /protein_id="AFM55927.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07:01:01 variant"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..787
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07:01:01 variant"
FT                   /number=3
XX
SQ   Sequence 787 BP; 105 A; 174 C; 198 G; 69 T; 241 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaactac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nggtctcaca ccctccagag gatgtatggc       540
     tgcgacctgg ggcccgacgg gcgcctcctc cgcgggtatg accagtccgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcctgga ccgccgcgga caccgcggct       660
     cagatcaccc agcgcaagtg ggaggcggcc cgtgcggcgg agcagctgag agcctacctg       720
     gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcgcag                                                                 787
//