spacer

EBI Dbfetch

ID   JQ828988; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   JQ828988;
XX
DT   18-JUN-2012 (Rel. 113, Created)
DT   18-JUN-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*05 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Zhu F., Wang W.;
RT   "A novel HLA-DQB1*05 allele was identified by PCR-SBT";
RL   Unpublished.
XX
RN   [2]
RP   1-652
RA   Zhu F., Wang W.;
RT   ;
RL   Submitted (27-MAR-2012) to the INSDC.
RL   HLA Laboratory, Transfusion Institute, Blood Center of Zhejiang Province,
RL   Wulin Road 345, Hangzhou, Zhejiang 310006, China
XX
DR   MD5; 9c78dd80a843f7a71fbbe2e82ab5670f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05"
FT   mRNA            join(<1..270,371..>652)
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:I6QTP4"
FT                   /db_xref="IMGT/HLA:DQB1*05:15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I6QTP4"
FT                   /protein_id="AFM31009.1"
FT                   /translation="DFVYQFKGLCYFTNGTERVRGVTRHIYNREEYVRFDSDVGVYRAV
FT                   TPQGRPDAEYWNSQKEVLEGARASVDRVCKHNYEVAYRGILQRRVEPTVTISPSRTEAL
FT                   NHHNLLICSVTDFYPSQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRG
FT                   DVYTCHVEHPSLQSPITVEW"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 652 BP; 123 A; 157 C; 177 G; 95 T; 100 other;
     aggatttcgt gtaccagttt aagggcctgt gctacttcac caacgggacg gagcgcgtgc        60
     ggggtgtgac cagacacatc tataaccgag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgcaggggc ggcctgacgc cgagtactgg aacagccaga       180
     aggaagtcct ggagggggcc cgggcgtcgg tggacagagt gtgcaaacac aactacgagg       240
     tggcgtaccg cgggatcctg cagaggagag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tggagcccac agtgaccatc tccccatcca ggacagaggc cctcaaccac       420
     cacaacctgc tgatctgctc ggtgacagat ttctatccaa gccagatcaa agtccggtgg       480
     tttcggaatg atcaggagga gacagccggc gttgtgtcca cccccctcat taggaacggt       540
     gactggacct tccagatcct ggtgatgctg gaaatgactc cccagcgtgg agatgtctac       600
     acctgccacg tggagcaccc cagcctccag agccccatca ccgtggagtg gc               652
//


spacer
spacer