spacer

EBI Dbfetch

ID   JQ824202; SV 1; linear; genomic DNA; STD; HUM; 2106 BP.
XX
AC   JQ824202;
XX
DT   18-JUN-2012 (Rel. 113, Created)
DT   18-JUN-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*07new allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2106
RA   Cho D., Kwon O.-J., Shin M.-G.;
RT   "HLA-C*07 New allele";
RL   Unpublished.
XX
RN   [2]
RP   1-2106
RA   Cho D., Kwon O.-J., Shin M.-G.;
RT   ;
RL   Submitted (26-MAR-2012) to the INSDC.
RL   Molecular Genetics, Biowithus Inc., Konkuk University, 508, Woolim e-BIZ
RL   Center, 280-21, Seongdong-gu, Seoul 133-120, Republic of Korea
XX
DR   MD5; 59a6454fc8ddcbebb4468596a52f9925.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2106
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2106
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07new"
FT   mRNA            join(<1..73,204..473,724..999,1587..1862,1987..>2106)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07new"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,724..999,1587..1862,1987..>2106)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:I6R1M9"
FT                   /db_xref="IMGT/HLA:C*07:244"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:I6R1M9"
FT                   /protein_id="AFM35817.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADQVSLRN
FT                   LRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSS"
XX
SQ   Sequence 2106 BP; 386 A; 651 C; 689 G; 380 T; 0 other;
     atgcgggtca tggcgccccg agccctcctc ctgctgctct cgggaggcct ggccctgacc        60
     gagacctggg cctgtgagtg cggggttggg agggaagcgg cctctgcgga gaggagcgag       120
     gggccctccc ggcgagggcg caggacccgg ggagccgcgc agggaggtgg gtcgggcggg       180
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttcgaca ccgccgtgtc       240
     ccggcccggc cgcggagagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga       360
     gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacaggc       420
     tgaccaagtg agcctgcgga acctgcgcgg ctactacaac cagagcgagg acggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tccccatccc ccacggacgg cccgggtcgc       540
     ccagagtctc cccgtctgag atccacccca aggtggatct gcggaacccg cccagaccct       600
     cgaccggaga gagccccagt cgcctttacc cggtttcatt ttcggtttag gccaaaatcc       660
     ccgcgggttg gtcggggcgg ggcggggctc gggggactgg gctgaccgcg ggggcggggc       720
     cagggtctca caccctccag aggatgtctg gctgcgacct ggggcccgac gggcgcctcc       780
     tccgcgggta tgaccagtcc gcctacgacg gcaaggatta catcgccctg aacgaggacc       840
     tgcgctcctg gaccgccgcg gacaccgcgg ctcagatcac ccagcgcaag ttggaggcgg       900
     cccgtgcggc ggagcagctg agagcctacc tggagggcac gtgcgtggag tggctccgca       960
     gatacctgga gaacgggaag gagacgctgc agcgcgcagg taccaggggc agtggggagc      1020
     cttccccatc tcctatagat ctcccgggat ggcctcccac gaggagggga ggaaaatggg      1080
     atcagcactg gaatatcgcc ctcccttgaa tggagaatgg catgagtttt cctgagtttc      1140
     ctctgagggc cccctctgct ctctaggaca attaagggat gaagtctctg aggaaatgga      1200
     ggggaagaca gtccctggaa tactgatcag gggtctcctt tgaccacttt gaccactgca      1260
     gcagctgtgg tcaggctgct gacctttctc tcaggccttg ttctctgcct cacactcaat      1320
     gtgtctgaag gtttgattcc agcttttctg agtcctgcag cctccactca ggtcaggacc      1380
     agaagtcgct gttcctccct cagagactag aactttccaa tgaataggag attatcccag      1440
     gtgcctgtgt ccaggctggc gtctgggttc tgtgccgcct tccccacccc aggtgtcctg      1500
     tccattctca ggatggtcac atgggcgctg ctggagtgtc ccaagagaga tgcaaagtgt      1560
     ctgaattttc tgactcttcc cgtcagaacc cccaaagaca cacgtgaccc accaccccct      1620
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac      1680
     actgacctgg cagcgggatg gggaggacca gacccaggac accgagcttg tggagaccag      1740
     gccagcagga gatggaacct tccagaagtg ggcagctgtg gtggtgcctt ctggacaaga      1800
     gcagagatac acgtgccata tgcagcacga ggggctgcaa gagcccctca ccctgagctg      1860
     gggtaaggag gggaatgggg ggtcacatct cttatcagag aaagcagaag tccttctgga      1920
     gcccttcagc cgggtcaggg ctgaggcttg ggggtcaggg cccctcacct tctcctcctt      1980
     tcccagagcc atcttcccag cccaccatcc ccatcatggg catcgttgct ggcctggctg      2040
     tcctggttgt cctagctgtc cttggagctg tggtcaccgc tatgatgtgt aggaggaaga      2100
     gctcag                                                                 2106
//


spacer
spacer