spacer

EBI Dbfetch

ID   JQ815887; SV 1; linear; genomic DNA; STD; HUM; 1663 BP.
XX
AC   JQ815887;
XX
DT   18-JUN-2012 (Rel. 113, Created)
DT   18-JUN-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*68 variant allele,
DE   exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1663
RA   Lozano-Ramos I., Gil J., Campos E., Ambros C., Caro P., Mantecon S.,
RA   Mongay L., Herrero M.J., Correa P., Colobran R., Palou E.;
RT   "Identification of a new HLA-A allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1663
RA   Lozano-Ramos I., Gil J., Campos E., Ambros C., Caro P., Mantecon S.,
RA   Mongay L., Herrero M.J., Correa P., Colobran R., Palou E.;
RT   ;
RL   Submitted (23-MAR-2012) to the INSDC.
RL   LIRAD, Banc de Sang i Teixits, Pg Taulat, 116, Barcelona 08005, Spain
XX
DR   MD5; 042057154547dbcc66a9056bf754a24c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1663
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1663
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68 variant"
FT   mRNA            join(<1..270,512..787,1388..>1663)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..787,1388..>1663)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:I6R1A7"
FT                   /db_xref="IMGT/HLA:A*68:92"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:I6R1A7"
FT                   /protein_id="AFM35649.1"
FT                   /translation="SHSMRYFYTSMSRPGRGKPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQRMYGCDVGP
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68 variant"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68 variant"
FT                   /number=3
FT   gap             788..1387
FT                   /estimated_length=600
FT   exon            1388..>1663
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68 variant"
FT                   /number=4
XX
SQ   Sequence 1663 BP; 173 A; 247 C; 281 G; 121 T; 841 other;
     gctcccactc catgaggtat ttctacacct ccatgtcccg gcccggccgc gggaagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccatccagag gatgtatggc       540
     tgcgacgtgg ggccggacgg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagaccacca agcacaagtg ggaggcggcc catgtggcgg agcagtggag agcctacctg       720
     gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnacg cccccaaaac gcatatgact caccacgctg tctctgacca tgaagccacc      1440
     ctgaggtgct gggccctgag cttctaccct gcggagatca cactgacctg gcagcgggat      1500
     ggggaggacc agacccagga cacggagctc gtggagacca ggcctgcagg ggatggaacc      1560
     ttccagaagt gggtggctgt ggtggtgcct tctggacagg agcagagata cacctgccat      1620
     gtgcagcatg agggtttgcc caagcccctc accctgagat ggg                        1663
//


spacer
spacer