Dbfetch

ID   JQ804940; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JQ804940;
XX
DT   17-JUL-2012 (Rel. 113, Created)
DT   17-JUL-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DRB1 (HLA-DQB1) gene, HLA-DQB1*06:02v allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Cao K., Zhao W., Guerrero E., Willis D., Barnes T., Liao S., Partlow D.,
RA   Cano P., Fernandez-Vina M.;
RT   "New Sequences of HLA Allele DQB1*06:02 Variant";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Cao K., Zhao W., Guerrero E., Willis D., Barnes T., Liao S., Partlow D.,
RA   Cano P., Fernandez-Vina M.;
RT   ;
RL   Submitted (20-MAR-2012) to the INSDC.
RL   HLA Laboratory, Dept of Laboratory Medicine, UT MD Anderson Cancer Center,
RL   8515 Fannin Street, Houston, TX 77054, USA
XX
DR   MD5; 3130e28de977c4368a55f876125e48b8.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: Assign v. 3.5.1.42
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06:02v"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06:02v"
FT                   /product="HLA-DRB1"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06:02v"
FT                   /product="HLA-DRB1"
FT                   /db_xref="GOA:I6X987"
FT                   /db_xref="IMGT/HLA:DQB1*06:50"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I6X987"
FT                   /protein_id="AFN52226.1"
FT                   /translation="DFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
FT                   TPQGRPDAEYWNSQKEVLEGTRAELHTVCRHNYEVAFRGILQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06:02v"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 66 C; 99 G; 47 T; 0 other;
     aggatttcgt gttccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtgac cagatacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtaccg cgcggtgacg ccgcaggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggaagtcct ggaggggacc cgggcggagt tgcacacggt gtgcagacac aactacgagg       240
     tggcgttccg cgggatcttg cagaggagag                                        270
//