spacer

EBI Dbfetch

ID   JQ804939; SV 1; linear; genomic DNA; STD; HUM; 789 BP.
XX
AC   JQ804939;
XX
DT   17-JUL-2012 (Rel. 113, Created)
DT   17-JUL-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens HLA-B (HLA-B) gene, HLA-B*40:02:01V allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-789
RA   Cao K., Guerrero E., Zhao W., Willis D., Barnes T., Smith N., Oyediran K.,
RA   Partlow D., Cano P., Fernandez-Vina M.;
RT   "New Sequences of HLA Allele of B*40:02:01 Variant";
RL   Unpublished.
XX
RN   [2]
RP   1-789
RA   Cao K., Guerrero E., Zhao W., Willis D., Barnes T., Smith N., Oyediran K.,
RA   Partlow D., Cano P., Fernandez-Vina M.;
RT   ;
RL   Submitted (20-MAR-2012) to the INSDC.
RL   HLA Laboratory, Dept of Laboratory Medicine, UT MD Anderson Cancer Center,
RL   8515 Fannin Street, Houston, TX 77054, USA
XX
DR   MD5; 907cc4d064c714361c34f410e7097df3.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: Assign v. 3.5.1.42
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..789
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>789
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:02:01V"
FT   mRNA            join(<1..270,514..>789)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:02:01V"
FT                   /product="HLA-B"
FT   CDS             join(<1..270,514..>789)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:02:01V"
FT                   /product="HLA-B"
FT                   /db_xref="GOA:I6YID7"
FT                   /db_xref="IMGT/HLA:B*40:206"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:I6YID7"
FT                   /protein_id="AFN52225.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHPLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:02:01V"
FT                   /number=2
FT   gap             271..513
FT                   /estimated_length=243
FT   exon            514..789
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:02:01V"
FT                   /number=3
XX
SQ   Sequence 789 BP; 111 A; 175 C; 190 G; 70 T; 243 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnggtctca ccccctccag agcatgtacg       540
     gctgcgacgt ggggccggac gggcgcctcc tccgcgggca taaccagtac gcctacgacg       600
     gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg gacacggcgg       660
     ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg agagcctacc       720
     tggagggcga gtgcgtggag tggctccgca gatacctgga gaacgggaag gagacgctgc       780
     agcgcgcgg                                                               789
//


spacer
spacer