spacer

EBI Dbfetch

ID   JQ801737; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   JQ801737;
XX
DT   18-JUL-2012 (Rel. 113, Created)
DT   18-JUL-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens isolate 7311120273 MHC class II antigen (HLA-DRB1) gene, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Su Y., Dai M.;
RT   "A new HLA-DRB1 allele is found through SBT in sample ID 7311120273 Yueyang
RT   Population";
RL   Unpublished.
XX
RN   [2]
RP   1-652
RA   Su Y., Dai M.;
RT   ;
RL   Submitted (20-MAR-2012) to the INSDC.
RL   Institute Of Transfusion Medicine Of Yueyang, The Central Blood Station Of
RL   Yueyang City, Baiyangpo Road 245, Yueyang, Hunan 414000, China
XX
DR   MD5; 7a60813f051757834afe791f0cb32ed5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /isolate="7311120273"
FT                   /mol_type="genomic DNA"
FT                   /country="China:Yueyang"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>652
FT                   /gene="HLA-DRB1"
FT   mRNA            join(<1..270,371..>652)
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:I6Z8F2"
FT                   /db_xref="IMGT/HLA:DRB1*09:18"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I6Z8F2"
FT                   /protein_id="AFN61289.1"
FT                   /translation="RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAV
FT                   TELGRPVAESWNRQKDFLERRRAEVDTVCRHNYGVGESFTVQRRVHPEVTVYPAKTQPL
FT                   QHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSVMSPLTVEW"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..652
FT                   /gene="HLA-DRB1"
FT                   /number=3
XX
SQ   Sequence 652 BP; 125 A; 134 C; 186 G; 107 T; 100 other;
     cacgtttctt gaagcaggat aagtttgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggtatctgca cagaggcatc tataaccaag aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagacaga       180
     aggacttcct ggagcggagg cgggccgagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagaggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tccatcctga ggtgactgtg tatcctgcca agactcagcc cctgcagcac       420
     cacaacctcc tggtctgctc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaacg gccaggaaga gaaggctggg gtggtgtcca caggcctgat ccagaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaagtttac       600
     acctgccaag tggagcaccc aagtgtgatg agccctctca cagtggaatg ga               652
//


spacer
spacer