spacer

EBI Dbfetch

ID   JQ801731; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   JQ801731;
XX
DT   18-JUL-2012 (Rel. 113, Created)
DT   18-JUL-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens isolate 7311121436 MHC class II antigen (HLA-DRB1) gene, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Dai M., Su Y.;
RT   "A new HLA-DRB1 allele is found through SBT in Yueyang Population sample ID
RT   7311121436";
RL   Unpublished.
XX
RN   [2]
RP   1-652
RA   Dai M., Su Y.;
RT   ;
RL   Submitted (20-MAR-2012) to the INSDC.
RL   Institute Of Transfusion Medicine Of Yueyang, The Central Blood Station Of
RL   Yueyang City, Baiyangpo Road 245, Yueyang, Hunan 414000, China
XX
DR   MD5; 0517b79fee5452b768ed11de7e592421.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /isolate="7311121436"
FT                   /mol_type="genomic DNA"
FT                   /country="China:Yueyang"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>652
FT                   /gene="HLA-DRB1"
FT   mRNA            join(<1..270,371..>652)
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:I6YAZ4"
FT                   /db_xref="IMGT/HLA:DRB1*13:01:13"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I6YAZ4"
FT                   /protein_id="AFN61283.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPL
FT                   QHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSVTSPLTVEW"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..652
FT                   /gene="HLA-DRB1"
FT                   /number=3
XX
SQ   Sequence 652 BP; 126 A; 139 C; 177 G; 110 T; 100 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtga        60
     ggttcctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tccatcctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgttc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaatg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccacaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtgaca agccctctca cagtggaatg ga               652
//


spacer
spacer