Dbfetch

ID   JQ743222; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   JQ743222;
XX
DT   25-JUN-2012 (Rel. 113, Created)
DT   25-JUN-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1 new allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Wu T., Yin B., Zhu Y., Chen C., Chen X.;
RT   "A new HLA-DQB1 allele is found through SBT in Shenzhen Population";
RL   Unpublished.
XX
RN   [2]
RP   1-652
RA   Wu T., Yin B., Zhu Y., Chen C., Chen X.;
RT   ;
RL   Submitted (06-MAR-2012) to the INSDC.
RL   Shenzhen Zhongshan Institute for Reproductive Medicine and Genetics,
RL   Shenzhen Zhongshan Urological Hospital, No. 1001, Fuqiang Road, Fuqiang
RL   District, Shenzhen, Guangdong 518001, China
XX
DR   MD5; 9bf37668d0d20c084a1c8902bf8a4228.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1 new"
FT   mRNA            join(<1..270,371..>652)
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1 new"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:I6T6X3"
FT                   /db_xref="IMGT/HLA:DQB1*03:43"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I6T6X3"
FT                   /protein_id="AFM68913.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGLVSTPLIRNGDWTFQILVMLEMTPQRG
FT                   DVYTCHVEHPSLQNPIIVEW"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1 new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1 new"
FT                   /number=3
XX
SQ   Sequence 652 BP; 125 A; 163 C; 164 G; 100 T; 100 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtgac cagatacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgctggggc cgcctgacgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tggagcccac agtgaccatc tccccatcca ggacagaggc cctcaaccac       420
     cacaacctgc tggtctgctc agtgacagat ttctatccag cccagatcaa agtccggtgg       480
     tttcggaatg accaggagga gacaactggc cttgtgtcca ccccccttat taggaacggt       540
     gactggacct tccagatcct ggtgatgctg gaaatgactc cccagcgtgg agacgtctac       600
     acctgccacg tggagcaccc cagcctccag aaccccatca tcgtggagtg gc               652
//