Dbfetch

ID   JQ629933; SV 1; linear; genomic DNA; STD; HUM; 237 BP.
XX
AC   JQ629933;
XX
DT   15-MAY-2012 (Rel. 112, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*12new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-237
RX   PUBMED; 22762239.
RA   Lim A.H., Song S.N., Shin G.S., Lee S.A., Kim M.H.;
RT   "A novel HLA-DRB1*12 allele, DRB1*12:16:02, identified by sequence-based
RT   typing";
RL   Tissue Antigens 80(3):278-279(2012).
XX
RN   [2]
RP   1-237
RA   Lim A.H., Shin G.S., Shin H.H., Song S.N., Kim M.H.;
RT   ;
RL   Submitted (07-FEB-2012) to the INSDC.
RL   Immuno-Hematology Division, Blood Transfusion Research Institute, 764,
RL   Sanggye 6-dong, Nowon-gu, Seoul 139-831, South Korea
XX
DR   MD5; f2fa16977218238e309da2909b93c433.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..237
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>237
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12new"
FT   mRNA            <1..>237
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>237
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:I2B1C4"
FT                   /db_xref="IMGT/HLA:DRB1*12:16:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I2B1C4"
FT                   /protein_id="AFJ44230.1"
FT                   /translation="GECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAVTELGRPV
FT                   AESWNSQKDFLEDRRAAVDTYCRHNYGVGESFTV"
FT   exon            <1..>237
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12new"
FT                   /number=2
XX
SQ   Sequence 237 BP; 48 A; 57 C; 88 G; 44 T; 0 other;
     ggtgagtgtt atttcttcaa tgggacggag cgggtgcggt tactggagag acacttccat        60
     aaccaggagg agctcctgcg cttcgacagc gacgtggggg agttccgggc ggtgacggag       120
     ctggggcggc ctgtcgccga gtcctggaac agccagaagg acttcctgga agacaggcgc       180
     gccgcggtgg acacctattg cagacacaac tacggggttg gtgagagctt cacagtg          237
//