Dbfetch

ID   JQ341055; SV 1; linear; genomic DNA; STD; HUM; 2981 BP.
XX
AC   JQ341055;
XX
DT   20-MAR-2012 (Rel. 112, Created)
DT   20-MAR-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C-HLA C*04:01:01 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2981
RA   Sayer D.C., Lind C., Castley A., Hogan H.M., Smith L.;
RT   "MHC haplotype specific SNPs in noncoding regions of HLA class I genes";
RL   Unpublished.
XX
RN   [2]
RP   1-2981
RA   Sayer D.C., Lind C., Castley A., Hogan H.M., Smith L.;
RT   ;
RL   Submitted (01-JAN-2012) to the INSDC.
RL   Conexio Genomics, 8/31 Pakenham St, Fremantle, WA 6160, Australia
XX
DR   MD5; 7694c2882169809f5504503dad7e5b08.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2981
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <28..>2922
FT                   /gene="HLA-C"
FT                   /allele="HLA C*04:01:01"
FT   mRNA            join(<28..100,231..500,747..1022,1610..1885,2007..2126,
FT                   2566..2598,2706..2753,2918..>2922)
FT                   /gene="HLA-C"
FT                   /allele="HLA C*04:01:01"
FT                   /product="MHC class I antigen"
FT   CDS             join(28..100,231..500,747..1022,1610..1885,2007..2126,
FT                   2566..2598,2706..2753,2918..2922)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA C*04:01:01"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q5D1W8"
FT                   /db_xref="IMGT/HLA:C*04:01:01:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q5D1W8"
FT                   /protein_id="AFD29103.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFSTSVSWPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPREPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWKPSSQPTIPIVGIVAGLAVLAVLAVLGAMVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
XX
SQ   Sequence 2981 BP; 564 A; 851 C; 949 G; 617 T; 0 other;
     ggactcagat tctccccaga cgccgagatg cgggtcatgg cgccccgaac cctcatcctg        60
     ctgctctcgg gagccctggc cctgaccgag acctgggccg gtgagtgcgg ggttgggagg       120
     gaaacggcct ctggggagag gagcgagggg cccgcccggc gagggcgcag gacccgggaa       180
     gccgcgcagg gaggagggtc gggcgggtct cagccactcc tcgtccccag gctcccactc       240
     catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc gcttcatcgc       300
     agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg cgagtccaag       360
     aggggagccg cgggagccgt gggtggagca ggaggggccg gagtattggg accgggagac       420
     acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac tgcgcggcta       480
     ctacaaccag agcgaggacg gtgagtgacc ccggcccggg gcgcaggtca cgacccctcc       540
     ccatccccca cggacggccc gggtcgcccc gagtctcccc gtctgagatc caccccgagg       600
     ctgcggaacc cgcccagacc ctcgaccgga gagagcccca gtcaccttta cccggtttca       660
     ttttcagttt aggccaaaat ccccgcgggt tggtcgggac tggggcgggg ctcgggggac       720
     cgggctgacc acgggggcgg ggccagggtc tcacaccctc cagaggatgt ttggctgcga       780
     cctggggccg gacgggcgcc tcctccgcgg gtataaccag ttcgcctacg acggcaagga       840
     ttacatcgcc ctgaacgagg atctgcgctc ctggaccgcc gcggacacgg cggctcagat       900
     cacccagcgc aagtgggagg cggcccgtga ggcggagcag cggagagcct acctggaggg       960
     cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc tgcagcgcgc      1020
     gggtaccagg ggcagtgggg agccttcccc atctcccgta gatctcccgg gatggcctcc      1080
     cacgaggagg ggaggaaaat gggatcagcg ctagaatatc gccctccctt gaatggagaa      1140
     tgggatgagt tttcctgagt ttcctctgag ggccccctct gctctctagg acaattaagg      1200
     gatgaagtcc ttgaggaaat ggaggggaag acagtccctg gaatactgat caggggtccc      1260
     ctttgaccac tttgaccact gcagcagctg tggtcaggct gctgaccttt ctctcaggcc      1320
     ttgttctctg cctgacgctc aatgtgtttg aaggtttgat tccagctttt ctgagtcctt      1380
     cggcctccac tcaggtcagg accagaagtc gctgttcctc cctcagagac tagaactttc      1440
     caatgaatag gagattatcc caggtgcctg tgtccaggct ggcgtctggg ttctgtgccc      1500
     ccttccccac cccaggtgtc ctgtccattc tcaggatggt cacatgggcg ctgttggagt      1560
     gtcgcaagag agatacaaag tgtctgaatt ttctgactct tcccatcaga acacccaaag      1620
     acacacgtga cccaccatcc cgtctctgac catgaggcca ccctgaggtg ctgggccctg      1680
     ggcttctacc ctgcggagat cacactgacc tggcagtggg atggggagga ccaaactcag      1740
     gacaccgagc ttgtggagac caggccagca ggagatggaa ccttccagaa gtgggcagct      1800
     gtggtggtgc cttctggaga agagcagaga tacacgtgcc atgttcagca cgaggggctg      1860
     ccggagcccc tcaccctgag atggagtaag gagggggatg aggggtgatg tgtcttctca      1920
     gggaaagcag aagtcctgga gcccttcagc cgggtcaggg ctgaggcttg gaggtcaggg      1980
     cccctcacct tcccctcctt tcccagagcc gtcttcccag cccaccatcc ccatcgtggg      2040
     catcgttgct ggcctggctg tcctggctgt cctagctgtc ctaggagcta tggtggctgt      2100
     tgtgatgtgt aggaggaaga gctcaggtag ggaaggggtg aggagtgggg tctgggtttt      2160
     cttgttccac tgggagtttc aagccccagg tagaagtgtg ccccacctcg ttactggaag      2220
     caccatccac acatgggcca tcccagcctg ggaccctgtg tgccagcact tactctgttg      2280
     tgaagcacat gacaatgaag gacagatgta tcaccttgat gattatggtg ttggggtcct      2340
     tgattccagc attcatgagt caggggaagg tccctgctaa ggacagacct taggagggca      2400
     gttgcttcag aacccacagc tgctttcccc gtgtttcctg atcctgccct gggtctgcag      2460
     tcatagttct ggaaacttct cttgggtcca agactaggag gttcccctaa gatcgcatgg      2520
     ccctgcctcc tccctgtccc ctcacagggc attttcttcc cacaggtgga aaaggaggga      2580
     gctgctctca ggctgcgtgt aagtgatggc ggtgggcgtg tggaggagct cacccacccc      2640
     ataattcctc ttgtcccaca tctcctgcgg gctctgacca ggtctttttt tttgttctac      2700
     cccagccagc aacagtgccc agggctctga tgagtctctc atcgcttgta aaggtgagat      2760
     tctggggagc tgaagtggtc gggggtgggg cagagggaaa aggcctaggt aatggggatc      2820
     ctttgattgg gacgtttcga atgtgtggtg agctgttcag agtgtcatca cttaccatga      2880
     ctgacctgaa tttgttcatg actattgtgt tctgtagcct gagacagctg cctgtgtggg      2940
     actgagatgc aggatttctt cacacctctc ctttgtgact t                          2981
//