Dbfetch

ID   JQ241149; SV 1; linear; genomic DNA; STD; HUM; 1195 BP.
XX
AC   JQ241149;
XX
DT   27-MAR-2012 (Rel. 112, Created)
DT   27-MAR-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*03:03 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1195
RA   Fuerst D., Zollikofer C., Recker K., Mytilineos J.;
RT   "A new variant of HLA-C*03:03";
RL   Unpublished.
XX
RN   [2]
RP   1-1195
RA   Fuerst D., Zollikofer C., Recker K., Mytilineos J.;
RT   ;
RL   Submitted (05-DEC-2011) to the INSDC.
RL   Transplant Immunology, Institute for Clinical Transfusion Medicine Ulm,
RL   Helmholtzstr. 10, Ulm, BW 89077, Germany
XX
DR   MD5; 338e72ca6d220bc2e4c013ebad5f0bb8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1195
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1195
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:03"
FT   mRNA            join(<1..73,174..443,544..819,920..>1195)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:03"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,544..819,920..>1195)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:03"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:H9C681"
FT                   /db_xref="IMGT/HLA:C*03:03:18"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:H9C681"
FT                   /protein_id="AFE88898.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEARSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRW"
FT   gap             74..173
FT                   /estimated_length=unknown
FT   gap             444..543
FT                   /estimated_length=unknown
FT   gap             820..919
FT                   /estimated_length=unknown
XX
SQ   Sequence 1195 BP; 180 A; 274 C; 312 G; 129 T; 300 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgctgtgtc ccggcccggc cgcggggagc cccacttcat       240
     cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagtcc       300
     gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg ccggagtatt gggaccggga       360
     gacgcagaag tacaagcgcc aggcacagac tgaccgagtg agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccannnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca catcatccag aggatgtatg gctgcgacgt ggggcccgac gggcgcctcc       600
     tccgcgggta tgaccagtac gcctacgacg gcaaggatta catcgccctg aacgaggatc       660
     tgcgctcctg gaccgccgcg gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgaggc ggagcagctg agagcctacc tggagggcct gtgcgtggag tggctccgca       780
     gatacctgaa gaatgggaag gagacgctgc agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna acacccaaag acacacgtga cccaccatcc cgtctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagtggg atggggagga ccaaactcag gacactgagc ttgtggagac caggccagca      1080
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacgtgcc atgtgcagca cgaggggctg ccggagcccc tcaccctgag atggg           1195
//