Dbfetch

ID   JQ219673; SV 1; linear; genomic DNA; STD; HUM; 1635 BP.
XX
AC   JQ219673;
XX
DT   27-MAR-2012 (Rel. 112, Created)
DT   25-APR-2012 (Rel. 112, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A23 variant allele,
DE   exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1635
RX   DOI; 10.1111/j.1399-0039.2012.01860.x.
RX   PUBMED; 22489949.
RA   Ferriola D., Heron S., Lind C., Monos D.S.;
RT   "Identification of a novel HLA-A*23 variant allele, A*23:50";
RL   Tissue Antigens 79(5):386-386(2012).
XX
RN   [2]
RP   1-1635
RA   Ferriola D., Heron S., Lind C., Hsiao T., Monos D.;
RT   ;
RL   Submitted (01-DEC-2011) to the INSDC.
RL   Immunogenetics Laboratory, The Children's Hospital of Philadelphia, 3516
RL   Civic Center Blvd., Abramson Research Bldg, Room 707B, Philadelphia, PA
RL   19104, USA
XX
DR   MD5; 4746bc63931fd6e024fbf28ec890d95d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1635
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1635
FT                   /gene="HLA-A"
FT                   /allele="HLA-A23 variant"
FT   mRNA            join(<1..270,512..787,1360..>1635)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A23 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..787,1360..>1635)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A23 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*23:50"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:H9C3L3"
FT                   /protein_id="AFE85516.1"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A23 variant"
FT                   /product="alpha 1 domain"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A23 variant"
FT                   /product="alpha 2 domain"
FT                   /number=3
FT   gap             788..1359
FT                   /estimated_length=572
FT   exon            1360..1635
FT                   /gene="HLA-A"
FT                   /allele="HLA-A23 variant"
FT                   /product="alpha 3 domain"
FT                   /number=4
XX
SQ   Sequence 1635 BP; 170 A; 249 C; 280 G; 123 T; 813 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccctccagat gatgtttggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcagttgag agcctacctg       720
     gagggcacgt gcgtggacgg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnna cccccccaag acacatatga      1380
     cccaccaccc catctctgac catgaggcca ctctgagatg ctgggccctg ggcttctacc      1440
     ctgcggagat cacactgacc tggcagcggg atggggagga ccagacccag gacacggagc      1500
     ttgtggagac caggcctgca ggggatggaa ccttccagaa gtgggcagct gtggtggtac      1560
     cttctggaga ggagcagaga tacacctgcc atgtgcagca tgagggtctg cccaagcccc      1620
     tcaccctgag atggg                                                       1635
//