spacer

EBI Dbfetch

ID   JQ085482; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   JQ085482;
XX
DT   25-MAR-2012 (Rel. 112, Created)
DT   27-JUN-2013 (Rel. 117, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-DQB) gene, HLA-DQB1*06:02:01 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RX   DOI; 10.1111/tan.12127.
RX   PUBMED; 23617470.
RA   He J.J., Zhang W., He J., Zhu F.M., Lv H.J.;
RT   "Characterization of a novel allele, HLA-DQB1*06:47";
RL   Tissue Antigens 82(1):74-75(2013).
XX
RN   [2]
RP   1-652
RA   Zhu F., Wang W., Zhang W.;
RT   "Identification a novel HLA-DQB1*06 allele";
RL   Unpublished.
XX
RN   [3]
RP   1-652
RA   Zhu F., Wang W., Zhang W.;
RT   ;
RL   Submitted (27-NOV-2011) to the INSDC.
RL   HLA Laboratory, Transfusion Institute, Blood Center of Zhejiang Province,
RL   Wulin Road 345, Hangzhou, Zhejiang 310006, China
XX
DR   MD5; e30f2ce67a69b072e05b153e94f8aab2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>652
FT                   /gene="HLA-DQB"
FT                   /allele="HLA-DQB1*06:02:01"
FT   mRNA            join(<1..270,371..>652)
FT                   /gene="HLA-DQB"
FT                   /allele="HLA-DQB1*06:02:01"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DQB"
FT                   /allele="HLA-DQB1*06:02:01"
FT                   /product="MHC class I antigen"
FT                   /note="HLA antigen"
FT                   /db_xref="GOA:H9BWE7"
FT                   /db_xref="IMGT/HLA:DQB1*06:47"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:H9BWE7"
FT                   /protein_id="AFD97749.1"
FT                   /translation="DFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
FT                   TPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRG
FT                   DVYTCQVEHPSLQSPITVEW"
FT   gap             271..370
FT                   /estimated_length=100
FT   variation       609
FT                   /gene="HLA-DQB"
FT                   /replace="c"
XX
SQ   Sequence 652 BP; 121 A; 153 C; 175 G; 103 T; 100 other;
     aggatttcgt gttccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtgac cagatacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtaccg cgcggtgacg ccgcaggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggaagtcct ggaggggacc cgggcggagt tggacacggt gtgcagacac aactacgagg       240
     tggcgttccg cgggatcttg cagaggagag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tggagcccac agtgaccatc tccccatcca ggacagaggc cctcaaccac       420
     cacaacctgc tggtctgctc ggtgacagat ttctatccag gccagatcaa agtccggtgg       480
     tttcggaatg atcaggagga gacagccggc gttgtgtcca ccccccttat taggaatggt       540
     gactggactt tccagatcct ggtgatgctg gaaatgactc cccagcgtgg agatgtctac       600
     acctgccaag tggagcaccc cagcctccag agccccatca ccgtggagtg gc               652
//


spacer
spacer