spacer

EBI Dbfetch

ID   JN990107; SV 1; linear; genomic DNA; STD; HUM; 1641 BP.
XX
AC   JN990107;
XX
DT   11-MAR-2012 (Rel. 112, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40:179 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1641
RX   PUBMED; 22607317.
RA   Kim K.M., Sung H.Y., Jung B., Kang M.S., Huh J.Y.;
RT   "HLA-B*40:179, a novel allele identified by sequence-based typing in cord
RT   blood from a Korean woman";
RL   Tissue Antigens 80(2):194-195(2012).
XX
RN   [2]
RP   1-1641
RA   Huh J.Y., Sung H.Y., Kang M.S.;
RT   ;
RL   Submitted (03-NOV-2011) to the INSDC.
RL   Laboratory Medicine, CHA Bundang Medical Center, CHA University, 351
RL   Yatap-dong, Bundang-gu, Seongnam-si, Gyeonggi-do 463-712, South Korea
XX
DR   MD5; 8493d204822b71d4e569c19f00ce2fc6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1641
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1641
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:179"
FT   mRNA            join(<1..270,516..791,1366..>1641)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:179"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..791,1366..>1641)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:179"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:H9BAN3"
FT                   /db_xref="IMGT/HLA:B*40:179"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:H9BAN3"
FT                   /protein_id="AFC90102.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTEPVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   gap             271..515
FT                   /estimated_length=245
FT   gap             792..1365
FT                   /estimated_length=574
XX
SQ   Sequence 1641 BP; 181 A; 256 C; 271 G; 114 T; 819 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacaccctcc agaggatgta       540
     cggctgcgac gtggggccgg acgggcgcct cctccgcggg cataaccagt acgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgcgctcc tggaccgccg cggacacggc       660
     ggctcagatc tcccagcgca agttggaggc ggcccgtgtg gcggagcagc tgagagccta       720
     cctggagggc gagtgcgtgg agtggctccg cagatacctg gagaacggga aggacaagct       780
     ggagcgcgct gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnacccc ccaaagacac      1380
     acgtgaccca ccaccccatc tctgaccatg aggccaccct gaggtgctgg gccctgggtt      1440
     tctaccctgc ggagatcaca ctgacctggc agcgggatgg cgaggaccaa actcaggaca      1500
     ctgagcctgt ggagaccaga ccagcaggag atagaacctt ccagaagtgg gcagctgtgg      1560
     tggtgccttc tggagaagag cagagataca catgccatgt acagcatgag gggctgccga      1620
     agcccctcac cctgagatgg g                                                1641
//


spacer
spacer