spacer

EBI Dbfetch

ID   JN987185; SV 1; linear; genomic DNA; STD; HUM; 1669 BP.
XX
AC   JN987185;
XX
DT   11-MAR-2012 (Rel. 112, Created)
DT   11-MAR-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*03:03:01V allele,
DE   exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1669
RA   Wang Q., Cao K., Semendyayeva M., Naim M., Lai C.-H., Ong G.,
RA   Reinsmoen N.L.;
RT   "Novel sequences of HLA-C*03:03:01 Variant";
RL   Unpublished.
XX
RN   [2]
RP   1-1669
RA   Wang Q., Cao K., Semendyayeva M., Naim M., Lai C.-H., Ong G.,
RA   Reinsmoen N.L.;
RT   ;
RL   Submitted (02-NOV-2011) to the INSDC.
RL   HLA Laboratory, Comprehensive Transplant Center, Department of Medicine,
RL   Cedars-Sinai Medical Center, 8723 Alden Dr. SSB 197, Los Angeles, CA 90048,
RL   USA
XX
DR   MD5; 5ba0032b9078140f489bf9a4a39c9d9e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1669
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="CS00126"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1669
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:03:01V"
FT   mRNA            join(<1..270,517..792,1394..>1669)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:03:01V"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..792,1394..>1669)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:03:01V"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:H9B8Z2"
FT                   /db_xref="IMGT/HLA:C*03:03:17"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:H9B8Z2"
FT                   /protein_id="AFC90105.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEARSHIIQRMYGCDVGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:03:01V"
FT                   /number=2
FT   gap             271..516
FT                   /estimated_length=246
FT   exon            517..792
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:03:01V"
FT                   /number=3
FT   gap             793..1393
FT                   /estimated_length=601
FT   exon            1394..1669
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:03:01V"
FT                   /number=4
XX
SQ   Sequence 1669 BP; 173 A; 245 C; 287 G; 117 T; 847 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggggagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggcca nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc tcacatcatc cagaggatgt       540
     atggctgcga cgtggggccc gacgggcgcc tcctccgcgg gtatgaccag tacgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg atctgcgctc ctggaccgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag ctgagagcct       720
     acctggaggg cctgtgcgtg gagtggctcc gcagatacct gaagaatggg aaggagacgc       780
     tgcagcgcgc ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnaacaccc aaagacacac gtgacccacc atcccgtctc tgaccatgag      1440
     gccaccctga ggtgctgggc cctgggcttc taccctgcgg agatcacact gacctggcag      1500
     tgggatgggg aggaccaaac tcaggacact gagcttgtgg agaccaggcc agcaggagat      1560
     ggaaccttcc agaagtgggc agctgtggtg gtgccttctg gagaagagca gagatacacg      1620
     tgccatgtgc agcacgaggg gctgccagag cccctcaccc tgagatggg                  1669
//


spacer
spacer