Dbfetch

ID   JN887337; SV 1; linear; mRNA; STD; HUM; 990 BP.
XX
AC   JN887337;
XX
DT   23-OCT-2012 (Rel. 114, Created)
DT   23-OCT-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) mRNA, HLA-C08:22-like allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-990
RA   Lank S.M., Golbach B.A., Creager H.M., Wiseman R.W., Keskin D.B.,
RA   Reinherz E.L., Brusic V., O'Connor D.H.;
RT   "Ultra-high resolution HLA genotyping and allele discovery by highly
RT   multiplexed cDNA amplicon pyrosequencing";
RL   Unpublished.
XX
RN   [2]
RP   1-990
RA   Lank S.M., Golbach B.A., Creager H.M., Wiseman R.W., Keskin D.B.,
RA   Reinherz E.L., Brusic V., O'Connor D.H.;
RT   ;
RL   Submitted (21-OCT-2011) to the INSDC.
RL   Wisconsin National Primate Research Center, University of Wisconsin
RL   Madison, 555 Science Drive, Madison, WI 53711, U.S.
XX
DR   MD5; dde11587704e9ccd577fec91fff93f55.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..990
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>990
FT                   /gene="HLA-C"
FT                   /allele="HLA-C08:22-like"
FT   CDS             <1..>990
FT                   /codon_start=2
FT                   /gene="HLA-C"
FT                   /allele="HLA-C08:22-like"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:K7DVA1"
FT                   /db_xref="IMGT/HLA:C*08:56"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:K7DVA1"
FT                   /protein_id="AFH75432.1"
FT                   /translation="WACSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASP
FT                   RGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCD
FT                   LGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARTAEQLRAYLE
FT                   GTCVEWLRRYPENGKKTLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRD
FT                   GEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWGPSSQ
FT                   PTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGGKGGSYSQAASS"
XX
SQ   Sequence 990 BP; 202 A; 301 C; 337 G; 150 T; 0 other;
     ctgggcctgc tcccactcca tgaggtattt ctacaccgcc gtgtcccggc ccggccgcgg        60
     agagccccgc ttcatcgcag tgggctacgt ggacgacacg cagttcgtgc agttcgacag       120
     cgacgccgcg agtccaagag gggagccgcg ggcgccgtgg gtggagcagg aggggccgga       180
     gtattgggac cgggagacac agaagtacaa gcgccaggca cagactgacc gagtgagcct       240
     gcggaacctg cgcggctact acaaccagag cgaggccggg tctcacaccc tccagaggat       300
     gtatggctgc gacctggggc ccgacgggcg cctcctccgc gggtataacc agttcgccta       360
     cgacggcaag gattacatcg ccctgaatga ggacctgcgc tcctggaccg ccgcggacac       420
     ggcggctcag atcacccagc gcaagtggga ggcggcccgt acggcggagc agctgagagc       480
     ctacctggag ggcacgtgcg tggagtggct ccgcagatac ccggagaacg ggaagaagac       540
     gctgcagcgc gcggaacacc caaagacaca cgtgacccac catcccgtct ctgaccatga       600
     ggccaccctg aggtgctggg ccctgggctt ctaccctgcg gagatcacac tgacctggca       660
     gcgggatggc gaggaccaaa ctcaggacac cgagcttgtg gagaccaggc cagcaggaga       720
     tggaaccttc cagaagtggg cagctgtggt ggtgccttct ggagaagagc agagatacac       780
     gtgccatgtg cagcacgagg ggctgccaga gcccctcacc ctgagatggg ggccatcttc       840
     ccagcccacc atccccatcg tgggcatcgt tgctggcctg gctgtcctgg ctgtcctagc       900
     tgtcctagga gctgtgatgg ctgttgtgat gtgtaggagg aagagctcag gtggaaaagg       960
     agggagctac tctcaggctg cgtccagcaa                                        990
//