Dbfetch

ID   JN862560; SV 1; linear; genomic DNA; STD; HUM; 796 BP.
XX
AC   JN862560;
XX
DT   27-FEB-2012 (Rel. 111, Created)
DT   27-FEB-2012 (Rel. 111, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-C) gene, HLA-C*07:var allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-796
RA   Recker K., Fuerst D., Stoetzer F., Mytilineos J.;
RT   ;
RL   Submitted (17-OCT-2011) to the INSDC.
RL   Transplantation Immunology, IKT Ulm, Helmholtzstrasse 10, Ulm 89081,
RL   Germany
XX
DR   MD5; b5e01dcf851fdcfa5afc567277425a05.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..796
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>796
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07:var"
FT   mRNA            join(<1..270,521..>796)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07:var"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,521..>796)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07:var"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:H6VQN8"
FT                   /db_xref="IMGT/HLA:C*07:220"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:H6VQN8"
FT                   /protein_id="AFB74727.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGKC
FT                   VEWLRRYLENGKETLQRA"
XX
SQ   Sequence 796 BP; 140 A; 264 C; 286 G; 106 T; 0 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctcc ccatccccca cggacggccc gggtcgccca gagtctcccc gtctgagatc       360
     caccccaagg tggatctgcg gaacccgccc agaccctcga ccggagagag ccccagtcgc       420
     ctttacccgg tttcattttc ggtttaggcc aaaatccccg cgggttggtc ggggcggggc       480
     ggggctcggg ggactgggct gaccgcgggg gcggggccag ggtctcacac cctccagagg       540
     atgtctggct gcgacctggg gcccgacggg cgcctcctcc gcgggtatga ccagtccgcc       600
     tacgacggca aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac       660
     accgcggctc agatcaccca gcgcaagttg gaggcggccc gtgcggcgga gcagctgaga       720
     gcctacctgg agggcaagtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag       780
     acgctgcagc gcgcag                                                       796
//