spacer

EBI Dbfetch

ID   JN794564; SV 1; linear; genomic DNA; STD; HUM; 251 BP.
XX
AC   JN794564;
XX
DT   19-FEB-2012 (Rel. 111, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-251
RX   PUBMED; 22888995.
RA   Abad M.L., Balas A., Schmidt A.H., Rodriguez-Calvo M.I., Vicario J.L.,
RA   Eiras A.;
RT   "A novel allele HLA-DPB1*136:01 identified in a German hematopoietic stem
RT   cell volunteer donor of Turkish descent";
RL   Tissue Antigens 80(5):471-472(2012).
XX
RN   [2]
RP   1-251
RA   Eiras A., Abad M., Balas A.;
RT   ;
RL   Submitted (28-SEP-2011) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre of Madrid, Avenida de la
RL   Democracia S/N, Madrid, Madrid 28032, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..251
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>251
FT                   /gene="HLA-DPB1"
FT   mRNA            <1..>251
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>251
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:H6V6L0"
FT                   /db_xref="IMGT/HLA:DPB1*136:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:H6V6L0"
FT                   /protein_id="AFA43492.1"
FT                   /translation="NYVYQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDLLEERRAVPDRMCRHNYELDEAVT"
XX
SQ   Sequence 251 BP; 60 A; 58 C; 93 G; 40 T; 0 other;
     agaattacgt gtaccagtta cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg atgaggagta ctggaacagc cagaaggacc       180
     tcctggagga gaggcgggca gtgccggaca ggatgtgcag acacaactac gagctggacg       240
     aggccgtgac c                                                            251
//


spacer
spacer