spacer

EBI Dbfetch

ID   JN696112; SV 1; linear; genomic DNA; STD; HUM; 2676 BP.
XX
AC   JN696112;
XX
DT   28-SEP-2011 (Rel. 110, Created)
DT   28-SEP-2011 (Rel. 110, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2676
RA   Planelles D., Balas A., Vicario J.L.;
RT   "Sequencing of a new HLA-B allele";
RL   Unpublished.
XX
RN   [2]
RP   1-2676
RA   Planelles D., Balas A., Vicario J.L.;
RT   ;
RL   Submitted (19-SEP-2011) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre of Madrid, Avenida de la
RL   Democracia S/N, Madrid 28032, Spain
XX
DR   MD5; f08c9b4724eaaedae63d87b79af851de.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2676
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2676
FT                   /gene="HLA-B"
FT   mRNA            join(<1..73,202..471,717..992,1567..1842,1936..2052,
FT                   2494..2526,2633..>2676)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,202..471,717..992,1567..1842,1936..2052,
FT                   2494..2526,2633..2676)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="leukocyte antigen B"
FT                   /db_xref="GOA:G5DSS2"
FT                   /db_xref="IMGT/HLA:B*08:79"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:G5DSS2"
FT                   /protein_id="AEP16443.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFDTAMSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
XX
SQ   Sequence 2676 BP; 500 A; 793 C; 853 G; 530 T; 0 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccggtgagtg cgggtcggga gggaaatggc ctctgccggg aggagcgagg       120
     ggaccgcagg cgggggcgca ggacctgagg agccgcgccg ggaggagggt cgggcgggtc       180
     tcagcccctc ctcgccccca ggctcccact ccatgaggta tttcgacacc gccatgtccc       240
     ggcccggccg cggggagccc cgcttcatct cagtgggcta cgtggacgac acgcagttcg       300
     tgaggttcga cagcgacgcc gcgagtccga gagaggagcc gcgggcgccg tggatagagc       360
     aggaggggcc ggagtattgg gaccggaaca cacagatctt caagaccaac acacagactg       420
     accgagagag cctgcggaac ctgcgcggct actacaacca gagcgaggcc ggtgagtgac       480
     cccggcccgg ggcgcaggtc acgactcccc atcccccacg gacggcccgg gtcgccccga       540
     gtctccgggt ccgagatccg cctccctgag gccgcgggac ccgcccagac cctcgaccgg       600
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       660
     ttggtcgggg cggggcgggg ctcgggggac tgggctgacc gcggggccgg ggccagggtc       720
     tcacaccctc cagagcatgt acggctgcga cgtggggccg gacgggcgcc tcctccgcgg       780
     gcataaccag tacgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgcgctc       840
     ctggaccgcc gcggacacgg cggctcagat cacccagcgc aagtgggagg cggcccgtga       900
     ggcggagcag cggagagcct acctggaggg cgagtgcgtg gagtggctcc gcagatacct       960
     ggagaacggg aaggacaagc tggagcgcgc tggtaccagg ggcagtgggg agccttcccc      1020
     atctcctata ggtcgccggg gatggcctcc cacgagaaga ggaggaaaat gggatcagcg      1080
     ctagaatgtc gccctccgtt gaatggagaa tggcatgagt tttcctgagt ttcctctgag      1140
     ggccccctct tctctctaga caattaagga atgacgtctc tgaggaaatg gaggggaaga      1200
     cagtccctag aatactgatc aggggtcccc tttgacccct gcagcagcct tgggaaccgt      1260
     gacttttcct ctcaggcctt gttctctgcc tcacactcag tgtgtttggg gctctgattc      1320
     cagcacttct gagtcacttt acctccactc agatcaggag cagaagtccc tgttccccgc      1380
     tcagagactc gaactttcca atgaatagga gattatccca ggtgcctgcg tccaggctgg      1440
     tgtctgggtt ctgtgcccct tccccacccc aggtgtcctg tccattctca ggctggtcac      1500
     atgggtggtc ctagggtgtc ccatgaaaga tgcaaagcgc ctgaattttc tgactcttcc      1560
     catcagaccc cccaaagaca cacgtgaccc accaccccat ctctgaccat gaggccaccc      1620
     tgaggtgctg ggccctgggt ttctaccctg cggagatcac actgacctgg cagcgggatg      1680
     gcgaggacca aactcaggac actgagcttg tggagaccag accagcagga gatagaacct      1740
     tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga gcagagatac acatgccatg      1800
     tacagcatga ggggctgccg aagcccctca ccctgagatg gggtaaggag ggggatgagg      1860
     ggtcatatct cttctcaggg aaagcaggag cccttcagca gggtcagggc ccctcatctt      1920
     cccctccttt cccagagccg tcttcccagt ccaccgtccc catcgtgggc attgttgctg      1980
     gcctggctgt cctagcagtt gtggtcatcg gagctgtggt cgctgctgtg atgtgtagga      2040
     ggaagagttc aggtagggaa ggggtgaggg gtggggtctg ggttttcttg tcccactggg      2100
     ggtttcaagc cccaggtaga agtgttccct gcctcattac tgggaagcag catgcacaca      2160
     ggggctaacg cagcctggga ccctgtgtgc cagcacttac tcttttgtgc agcacatgtg      2220
     acaatgaagg atggatgtat caccttgatg gttgtggtgt tggggtcctg attccagcat      2280
     tcatgagtcg ggggaaggtc cctgctaagg acagacctta ggagggcagt tggtccagga      2340
     cccacacttg ctttcctcgt gtttcctgat cctgccctgg gtctgtagtc atacttctgg      2400
     aaattccttt tgggtccaag actaggaggt tcctctaaga tctcatggcc ctgcttcctc      2460
     ccagtgccct cacaggacat tttcttccca caggtggaaa aggagggagc tactctcagg      2520
     ctgcgtgtaa gtggtggggg tgggagtgtg gaggagctca cccaccccat aattcctcct      2580
     gtcccacgtc tcctgcgggc tctgaccagg tcctgttttt gttctactcc aggcagcgac      2640
     agtgcccagg gctctgatgt gtctctcaca gcttga                                2676
//


spacer
spacer