Dbfetch

ID   JN626224; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JN626224;
XX
DT   25-JAN-2012 (Rel. 111, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*16 new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   PUBMED; 22803809.
RA   Li Z., Jin S.Z., Zou H.Y., Cheng L.H.;
RT   "Identification of a new HLA-DRB1 *16 variant, DRB1*16:19 by sequence-based
RT   typing in a Chinese Han";
RL   Tissue Antigens 80(4):388-390(2012).
XX
RN   [2]
RP   1-270
RA   Li Z., Jin S.-Z., Zou H.-Y.;
RT   ;
RL   Submitted (28-AUG-2011) to the INSDC.
RL   Immunogentics and Histocompatiblity Testing Laboratory, Shenzhen Blood
RL   Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; ea1e944aeed76cecf680e9dcf26557f0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*16 new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*16 new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*16 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:H2DLU4"
FT                   /db_xref="IMGT/HLA:DRB1*16:19"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:H2DLU4"
FT                   /protein_id="AEY68571.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVHFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*16 new"
FT                   /number=2
FT   variation       103
FT                   /gene="HLA-DRB1"
FT                   /replace="g"
FT                   /note="results in arginine to hitadine substitution"
XX
SQ   Sequence 270 BP; 58 A; 67 C; 98 G; 47 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcacttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacctcct ggaagacagg cgcgccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//