spacer

EBI Dbfetch

ID   JN383941; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JN383941;
XX
DT   04-DEC-2011 (Rel. 111, Created)
DT   04-DEC-2011 (Rel. 111, Last updated, Version 1)
XX
DE   Homo sapiens isolate BY00893 MHC class II antigen (HLA-DRB1) gene,
DE   HLA-DRB1*11:04:05 variant allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lazaro A.M., Peters J., Hurley C.K.;
RT   "Novel HLA class II alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Lazaro A.M., Peters J., Hurley C.K.;
RT   ;
RL   Submitted (22-JUL-2011) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 53fac78762b08099ce0b0829bd69b6dd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00893"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11:04:05 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11:04:05 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11:04:05 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:G9HRM5"
FT                   /db_xref="IMGT/HLA:DRB1*11:102:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:G9HRM5"
FT                   /protein_id="AEU10157.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11:04:05 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 64 C; 97 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer