spacer

EBI Dbfetch

ID   JN209959; SV 1; linear; genomic DNA; STD; HUM; 2064 BP.
XX
AC   JN209959;
XX
DT   11-DEC-2011 (Rel. 111, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*31 new allele, exons 1
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2064
RX   PUBMED; 23398511.
RA   Chen Y.F., Yang L., Zhuang Y.L., Nie X.M., Zhu C.F.;
RT   "A novel HLA-A allele, A*31:65, was identified by sequence-based typing in
RT   a Chinese potential donor";
RL   Tissue Antigens 81(3):173-175(2013).
XX
RN   [2]
RP   1-2064
RA   Zhu C., Song Y., Nie X., Zhuang Y., Zhang Y., Liu Y.;
RT   "Identification of a novel HLA-A*31 allele by sequence-based typing";
RL   Unpublished.
XX
RN   [3]
RP   1-2064
RA   Zhu C., Song Y., Nie X., Zhuang Y., Zhang Y., Liu Y.;
RT   ;
RL   Submitted (29-JUN-2011) to the INSDC.
RL   HLA Lab, The Blood Center of Shandong Province, 22 Shanshi East Road,
RL   Jinan, Shandong Province 250014, China
XX
DR   MD5; 8db34ef2c2214d6c0c4db73d016a2f6b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2064
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2064
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 new"
FT   mRNA            join(<1..73,204..473,715..990,1570..1845,1948..>2064)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..73,204..473,715..990,1570..1845,1948..>2064)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:G9FTJ9"
FT                   /db_xref="IMGT/HLA:A*31:65"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:G9FTJ9"
FT                   /protein_id="AEV42056.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAHSQIDRVDLGT
FT                   LRGHYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRKSS"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 new"
FT                   /number=1
FT   gap             74..203
FT                   /estimated_length=130
FT   exon            204..473
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 new"
FT                   /number=2
FT   variation       452
FT                   /gene="HLA-A"
FT                   /replace="t"
FT   gap             474..714
FT                   /estimated_length=241
FT   exon            715..990
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 new"
FT                   /number=3
FT   gap             991..1569
FT                   /estimated_length=579
FT   exon            1570..1845
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 new"
FT                   /number=4
FT   gap             1846..1947
FT                   /estimated_length=102
FT   exon            1948..2064
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 new"
FT                   /number=5
XX
SQ   Sequence 2064 BP; 191 A; 311 C; 343 G; 167 T; 1052 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct tgggggccct ggccctgacc        60
     cagacctggg cggnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn nnngctccca ctccatgagg tatttcacca catccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagagg cctgagtatt gggaccagga gacacggaat gtgaaggccc actcacagat       420
     tgaccgagtg gacctgggga ccctgcgcgg ccactacaac cagagcgagg ccgnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnngttctc       720
     acaccatcca gatgatgtat ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt       780
     accagcagga cgcctacgac ggcaaggatt acatcgcctt gaacgaggac ctgcgctctt       840
     ggaccgcggc ggacatggcg gctcagatca cccagcgcaa gtgggaggcg gcccgtgtgg       900
     cggagcagtt gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnnna cccccccaag acgcatatga ctcaccacgc tgtctctgac catgaggcca      1620
     ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc tggcagcggg      1680
     atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca ggggatggaa      1740
     ccttccagaa gtgggcgtct gtggtggtgc cttctggaca ggagcagaga tacacctgcc      1800
     atgtgcagca tgagggtctc cccaagcccc tcaccctgag atgggnnnnn nnnnnnnnnn      1860
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1920
     nnnnnnnnnn nnnnnnnnnn nnnnnnnagc cgtcttccca gcccaccatc cccatcgtgg      1980
     gcatcattgc tggcctagtt ctctttggag ctgtgttcgc tggagctgtg gtcgctgctg      2040
     tgaggtggag gaggaagagc tcag                                             2064
//


spacer
spacer