spacer

EBI Dbfetch

ID   JN119471; SV 1; linear; genomic DNA; STD; HUM; 788 BP.
XX
AC   JN119471;
XX
DT   01-AUG-2011 (Rel. 109, Created)
DT   01-AUG-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens clone C_100056_03807 MHC class I antigen (HLA-C) gene, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-788
RA   Cereb N., Yang S.Y.;
RT   "HLA new alleles found by Histogenetics";
RL   Unpublished.
XX
RN   [2]
RP   1-788
RA   Cereb N., Yang S.Y.;
RT   ;
RL   Submitted (14-JUN-2011) to the INSDC.
RL   Histogenetics, 300 Executive Blvd, Ossining, NY 10562, USA
XX
DR   MD5; 137d13746825f7b4c9bbec98c55d9df4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..788
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="C_100056_03807"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>788
FT                   /gene="HLA-C"
FT   mRNA            join(<1..270,513..>788)
FT                   /gene="HLA-C"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,513..>788)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:G1EMU3"
FT                   /db_xref="IMGT/HLA:C*02:02:24"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:G1EMU3"
FT                   /protein_id="AEK95202.1"
FT                   /translation="SHSMRYFYTAVSRPSRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /number=2
FT   gap             271..512
FT                   /estimated_length=242
FT   exon            513..788
FT                   /gene="HLA-C"
FT                   /number=3
XX
SQ   Sequence 788 BP; 111 A; 168 C; 198 G; 69 T; 242 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccagccgc ggagagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggtctcac accctccaga ggatgtacgg       540
     ctgcgacctg gggcccgacg ggcgcctcct ccgcgggtat gaccagtcgg cctacgacgg       600
     caaggattac atcgccctga acgaggacct gcgctcctgg accgccgcgg acacagcggc       660
     tcagatcacc cagcgcaagt gggaggcggc ccgtgaggcg gagcagtgga gagcctacct       720
     ggagggcgag tgcgtggagt ggctccgcag atacctggag aacgggaagg agacgctgca       780
     gcgcgcgg                                                                788
//


spacer
spacer