spacer

EBI Dbfetch

ID   JN093308; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JN093308;
XX
DT   21-DEC-2011 (Rel. 111, Created)
DT   21-DEC-2011 (Rel. 111, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*09 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Zuo J., Zhang D., Feng G.;
RT   "A novel allele HLA-DRB1*09 Identified by SBT";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Zuo J., Zhang D., Feng G.;
RT   ;
RL   Submitted (08-JUN-2011) to the INSDC.
RL   HLA Lab, Taiyuan Red Cross Blood Center, No.185 Taiyuan Yingze West Street,
RL   Taiyuan, Shanxi 030024, China
XX
DR   MD5; 90e679e6ea93be76afa5945704a24115.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:G9F9T9"
FT                   /db_xref="IMGT/HLA:DRB1*09:01:09"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:G9F9T9"
FT                   /protein_id="AEW11399.1"
FT                   /translation="RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDFLERRRAEVDTVCRHNYGVGESFTVQRR"
FT   variation       161
FT                   /gene="HLA-DRB1"
FT                   /replace="c"
XX
SQ   Sequence 270 BP; 60 A; 60 C; 103 G; 47 T; 0 other;
     cacgtttctt gaagcaggat aagtttgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggtatctgca cagaggcatc tataaccaag aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc ggagtcctgg aacagccaga       180
     aggacttcct ggagcggagg cgggccgagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagaggcgag                                        270
//


spacer
spacer