Dbfetch

ID   JN089769; SV 1; linear; genomic DNA; STD; HUM; 1915 BP.
XX
AC   JN089769;
XX
DT   07-AUG-2011 (Rel. 109, Created)
DT   12-DEC-2012 (Rel. 115, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I chain-related protein B (MICB) gene, MICB*NEW-T65
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1915
RX   DOI; 10.1016/j.humimm.2012.05.008.
RX   PUBMED; 22609444.
RA   Liu X., Li L., Pan F., Tian W.;
RT   "MICB polymorphism in a southern Chinese Han population: the identification
RT   of two new MICB alleles, MICB*005:06 and MICB*026";
RL   Hum. Immunol. 73(8):818-823(2012).
XX
RN   [2]
RP   1-1915
RA   Liu X., Tian W.;
RT   ;
RL   Submitted (07-JUN-2011) to the INSDC.
RL   Immunogenetics Research Group, Department of Immunology, College of Basic
RL   Medical Sciences, Central South University, Tongzipo Road 172#, Changsha,
RL   Hunan 410013, People's Republic of China
XX
DR   MD5; ae172442ae3d77b6bb121d781f0e168a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1915
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_name: forward, fwd_seq:
FT                   agtggagaggagcagccctgttccctgcat, rev_name: reverse, rev_seq:
FT                   agagagccacagccgtccctgctgtt"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1915
FT                   /gene="MICB"
FT                   /allele="MICB*NEW-T65"
FT   mRNA            join(<1..255,527..814,1406..1684,1784..>1915)
FT                   /gene="MICB"
FT                   /allele="MICB*NEW-T65"
FT                   /product="MHC class I chain-related protein B"
FT   CDS             join(<1..255,527..814,1406..1684,1784..>1915)
FT                   /codon_start=3
FT                   /gene="MICB"
FT                   /allele="MICB*NEW-T65"
FT                   /product="MHC class I chain-related protein B"
FT                   /db_xref="IMGT/HLA:MICB*005:06"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:G1EFQ4"
FT                   /protein_id="AEK67483.1"
FT                   /translation="PHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQ
FT                   GQWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTR
FT                   GSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADC
FT                   LQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQS
FT                   QRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGP"
FT   gap             256..526
FT                   /estimated_length=271
FT   gap             815..1405
FT                   /estimated_length=591
FT   variation       1554
FT                   /gene="MICB"
FT                   /replace="g"
FT                   /note="compared to MICB*005:02"
XX
SQ   Sequence 1915 BP; 242 A; 255 C; 265 G; 192 T; 961 other;
     agccccacag tcttcgttac aacctcatgg tgctgtccca ggatggatct gtgcagtcag        60
     ggtttctcgc tgagggacat ctggatggtc agcccttcct gcgctatgac aggcagaaac       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggagctaag acctgggaca       180
     cagagaccga ggacttgaca gagaatgggc aagacctcag gaggaccctg actcatatca       240
     aggaccagaa aggagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnngctt gcattccctc       540
     caggagatta gggtctgtga gatccatgaa gacagcagca ccaggggctc ccggcatttc       600
     tactacgatg gggagctctt cctctcccaa aacctggaga ctcaagaatc gacagtgccc       660
     cagtcctcca gagctcagac cttggctatg aacgtcacaa atttctggaa ggaagatgcc       720
     atgaagacca agacacacta tcgcgctatg caggcagact gcctgcagaa actacagcga       780
     tatctgaaat ccggggtggc catcaggaga acagnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnntgccc cccatggtga atgtcacctg cagcgaggtc      1440
     tcagagggca acatcaccgt gacatgcagg gcttccagct tctatccccg gaatatcaca      1500
     ctgacctggc gtcaggatgg ggtatctttg agccacaaca cccagcagtg gggtgatgtc      1560
     ctgcctgatg ggaatggaac ctaccagacc tgggtggcca ccaggattcg ccaaggagag      1620
     gagcagaggt tcacctgcta catggaacac agcgggaatc acggcactca ccctgtgccc      1680
     tctgnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnggaaggc gctggtgctt      1800
     cagagtcaac ggacagactt tccatatgtt tctgctgcta tgccatgttt tgttattatt      1860
     attattctct gtgtcccttg ttgcaagaag aaaacatcag cggcagaggg tccag           1915
//