spacer

EBI Dbfetch

ID   JF895477; SV 1; linear; mRNA; STD; HUM; 768 BP.
XX
AC   JF895477;
XX
DT   05-OCT-2011 (Rel. 110, Created)
DT   05-OCT-2011 (Rel. 110, Last updated, Version 1)
XX
DE   Homo sapiens isolate S0691-2208 MHC class II antigen (HLA-DQA1) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-768
RA   Han F., Bacelar M., Rozemuller E.H.;
RT   ;
RL   Submitted (27-APR-2011) to the INSDC.
RL   Beijing Medical University Center for Sleep Disorder Treatment, China
XX
DR   MD5; 1c6217fff44e64f4cc572a5540220ba7.
DR   Ensembl-Gn; ENSG00000228284; homo_sapiens.
DR   Ensembl-Tr; ENST00000420385; homo_sapiens.
DR   Ensembl-Tr; ENST00000441297; homo_sapiens.
DR   Ensembl-Tr; ENST00000450614; homo_sapiens.
DR   Ensembl-Tr; ENST00000456258; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..768
FT                   /organism="Homo sapiens"
FT                   /isolate="S0691-2208"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..768
FT                   /gene="HLA-DQA1"
FT   CDS             1..768
FT                   /codon_start=1
FT                   /gene="HLA-DQA1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5Y7H0"
FT                   /db_xref="IMGT/HLA:DQA1*03:03:02"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5Y7H0"
FT                   /protein_id="AEP60146.1"
FT                   /translation="MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPS
FT                   GQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSN
FT                   STAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSF
FT                   LSKSDHSFFKISYLTFLPSDDEIYDCKVEHWGLDEPLLKHWEPEIPTPMSELTETVVCA
FT                   LGLSVGLVGIVVGTVLIIRGLRSVGASRHQGPL"
XX
SQ   Sequence 768 BP; 167 A; 200 C; 198 G; 203 T; 0 other;
     atgatcctaa acaaagctct gatgctgggg gccctcgccc tgaccaccgt gatgagccct        60
     tgtggaggtg aagacattgt ggctgaccat gttgcctctt acggtgtaaa cttgtaccag       120
     tcttatggtc cctctgggca gtacagccat gaatttgatg gagacgagga gttctatgtg       180
     gacctggaga ggaaggagac tgtctggcag ttgcctctgt tccgcagatt tagaagattt       240
     gacccgcaat ttgcactgac aaacatcgct gtgctaaaac ataacttgaa catcgtgatt       300
     aaacgctcca actctaccgc tgctaccaat gaggttcctg aggtcacagt gttttccaag       360
     tctcccgtga cactgggtca gcccaacacc cttatctgtc ttgtggacaa catctttcct       420
     cctgtggtca acatcacctg gctgagcaat gggcactcag tcacagaagg tgtttctgag       480
     accagcttcc tctccaagag tgatcattcc ttcttcaaga tcagttacct caccttcctc       540
     ccttctgatg atgagattta tgactgcaag gtggagcact ggggcctgga tgagcctctt       600
     ctgaaacact gggagcctga gattccaaca cctatgtcag agctcacaga gactgtggtc       660
     tgcgccctgg ggttgtctgt gggcctcgtg ggcattgtgg tggggaccgt cttgatcatc       720
     cgaggcctgc gttcagttgg tgcttccaga caccaagggc ccttgtga                    768
//


spacer
spacer