spacer

EBI Dbfetch

ID   JF693895; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   JF693895;
XX
DT   14-JUL-2011 (Rel. 109, Created)
DT   14-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*08var allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Recker K., Fuerst D., Robin-Winn M., Mytilineos J.;
RT   "A new variant of HLA-B*08";
RL   Unpublished.
XX
RN   [2]
RP   1-792
RA   Recker K., Fuerst D., Robin-Winn M., Mytilineos J.;
RT   ;
RL   Submitted (15-MAR-2011) to the INSDC.
RL   Transplantation Immunology, IKT Ulm, Helmholtzstrasse 10, Ulm 89081,
RL   Germany
XX
DR   MD5; fb36c84587a0ed483d0755da7826d85a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>792
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08var"
FT   mRNA            join(<1..270,517..>792)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08var"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08var"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:G1BJ51"
FT                   /db_xref="IMGT/HLA:B*08:70"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:G1BJ51"
FT                   /protein_id="AEJ87204.1"
FT                   /translation="SHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQWRAYLEGTC
FT                   VEWLRRYLENGKDTLERA"
XX
SQ   Sequence 792 BP; 143 A; 263 C; 286 G; 100 T; 0 other;
     gctcccactc catgaggtat ttcgacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgg acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcggggggac ggggctgacc gcggggccgg ggccagggtc tcacaccctc cagagcatgt       540
     acggctgcga cgtggggccg gacgggcgcc tcctccgcgg gcataaccag tacgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcg gcggacaccg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag tggagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggacacgc       780
     tggagcgcgc gg                                                           792
//


spacer
spacer