Dbfetch

ID   JF414116; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JF414116;
XX
DT   21-JUN-2011 (Rel. 109, Created)
DT   21-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*03:64 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Planelles D., Antonio B., Vicario J.L.;
RT   "Sequencing of a new DRB1*03 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Planelles D., Antonio B., Vicario J.L.;
RT   ;
RL   Submitted (21-FEB-2011) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre of Madrid, Avenida de la
RL   Democracia s/n, Madrid 28032, Spain
XX
DR   MD5; 8edd47cfd12098c3bea12b494f7a95a5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03:64"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03:64"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03:64"
FT                   /product="MHC class II antigen"
FT                   /note="human leukocyte antigen; HLA-DR"
FT                   /db_xref="GOA:F8TVR8"
FT                   /db_xref="IMGT/HLA:DRB1*03:64"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:F8TVR8"
FT                   /protein_id="AEH95528.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAQYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 59 A; 65 C; 97 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc ccagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//